KEGG   Ilyobacter polytropus: Ilyop_0832Help
Entry
Ilyop_0832        CDS       T01337                                 

Definition
fructose-16-bisphosphatase
Orthology
K04041  
fructose-1,6-bisphosphatase III [EC:3.1.3.11]
Organism
ipo  Ilyobacter polytropus
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:ipo01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:ipo00010]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:ipo00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:ipo00051]
Metabolism; Energy metabolism; Methane metabolism [PATH:ipo00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
937457..939406
Genome map
AA seq 649 aa AA seqDB search
MRDLDYLKLLSKQYPSVADVANEIINLKAILNLPKGTEHFLTDMHGEYEAFSYHLRSASG
VLKFKIDDIFGHTLTMDEKKNLATLIIYPEKRLKYVKTSYSGSMTEWYKVTIYRLITICK
VVSSKYTRSKVKKALPSDFNYILDELLNIESKQLNKEKYYNEIVDTIVELERADRFIVAI
CGLVQKLAVDILHIMGDIYDRGPGPHLIMDELMKHSNVDIQWGNHDILWMGAALGHQTMI
AEVLRIALRYSNVECLEEGYGINLLPLGSLAMTVYKDDPCKEFMPKVSNEQFYEEKDKLL
IARMHKAIAIIQFKLEGQLIKRKEEFKRTDRLLLDMVDYERGVLTIDGVEYPLTSCNFPT
IDSNNPYVLTKYEKEVIDKLSSYFKNSEKLQKHIYYFYTNGSLYLKYNGNLLYHGCILLD
EKGDYLNAFIEGKKYKGVELLDKYEELARRAYFTRKESDIDWLWYLWTGRKSPMFAKEKM
ATFERYFTTDKKLHEEKLNPYFKYREDESICRKILESFDLDPDSGHIITGHTPVKVKKGE
SPLKANGKLLVIDGGMSRAYQNTTGIAGYTLMYNSWGLRLVSHHPFTSEDEIVREGVKIN
SNIDVLQKTNRKTVGDTDIGRKLLSQIDDLKELMTVYRSGQIQERRKKL
NT seq 1950 nt NT seq  +upstreamnt  +downstreamnt
atgagagatttggattatttaaaacttttatcgaaacagtaccctagcgttgcagatgta
gcaaatgagattataaaccttaaggcgatactaaatttgcctaaggggacagaacatttc
ctaacagatatgcacggagaatatgaggcattttcatatcatctaagaagtgcttcaggt
gttttaaaatttaagatagatgatatttttggacatacactgactatggatgaaaaaaag
aatctggcaactttgataatatatcctgaaaagcgtcttaaatatgttaaaacttcttac
agcggttctatgactgaatggtataaggtaactatttacagacttattactatctgcaaa
gttgtctcatcaaaatatactcgttctaaagtaaaaaaagccttaccctctgattttaat
tatattcttgatgaacttcttaatattgaaagtaaacaactgaataaggaaaaatactat
aatgaaatagttgacacgatagtagaattagagagagccgacaggtttatagtggctata
tgtggattggtacagaagttagcagtagatatacttcatatcatgggagatatatatgac
agaggtcccggtccccatcttataatggatgagcttatgaagcattcaaatgtcgacatt
caatggggaaaccatgatattttatggatgggagccgctttaggacaccagacaatgata
gcagaggtcttgagaatagctcttagatacagcaatgtagaatgtttagaggaggggtac
ggaataaatctccttcctttgggctctttggctatgacagtatataaagatgatccctgc
aaagaattcatgccaaaggtaagcaacgaacagttttacgaagaaaaggacaagcttttg
attgctagaatgcataaagcgatagcaataatacaatttaagctagagggacagttaatc
aagagaaaagaagaatttaagaggacagacaggctacttttggacatggtagactatgaa
cgtggagttctaacaatagacggggtcgagtaccctctaactagctgtaattttcctaca
attgattctaataatccatatgtacttacaaaatatgaaaaagaagtaattgataagttg
tcttcttattttaaaaacagtgaaaaactgcaaaaacacatatattatttttatacaaat
ggaagtctttacttgaaatataacgggaatttattgtatcacgggtgtatactcttagat
gaaaaaggagactacctcaatgcttttatagagggtaaaaagtataaaggtgtggaactt
ttagataaatatgaagagttggccagaagggcatattttacaagaaaagaaagtgatata
gactggttgtggtatttatggactggtagaaagtcgcctatgttcgccaaggaaaaaatg
gcaacttttgaaaggtattttactacagacaaaaaacttcatgaagaaaaactaaatcca
tatttcaaatacagagaagatgaatccatctgcagaaaaatacttgaaagttttgatctc
gatcctgatagtggacatataataactggtcatactcctgtgaaggtgaaaaaaggagag
agccctctaaaggctaatggaaaacttttggttatagatggtggtatgtctagagcatac
caaaataccacgggaatcgctgggtatactctgatgtataattcttggggactgagactg
gtatcccatcaccctttcacatctgaagatgaaatagtaagagaaggggtaaaaattaat
tctaatatcgatgttttacaaaagacaaatagaaaaacagtgggagacactgatataggt
agaaaattactttctcagattgatgatctaaaagaacttatgacggtatacagaagtggt
cagatacaagagcgaagaaaaaagttataa

DBGET integrated database retrieval system