KEGG   Ilyobacter polytropus: Ilyop_0832Help
Entry
Ilyop_0832        CDS       T01337                                 

Definition
fructose-16-bisphosphatase
Orthology
K04041  
fructose-1,6-bisphosphatase III [EC:3.1.3.11]
Organism
ipo  Ilyobacter polytropus
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ipo00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Ilyop_0832
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Ilyop_0832
   00030 Pentose phosphate pathway
    Ilyop_0832
   00051 Fructose and mannose metabolism
    Ilyop_0832
  Energy metabolism
   00680 Methane metabolism
    Ilyop_0832
Enzymes [BR:ipo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     Ilyop_0832
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
937457..939406
Genome map
AA seq 649 aa AA seqDB search
MRDLDYLKLLSKQYPSVADVANEIINLKAILNLPKGTEHFLTDMHGEYEAFSYHLRSASG
VLKFKIDDIFGHTLTMDEKKNLATLIIYPEKRLKYVKTSYSGSMTEWYKVTIYRLITICK
VVSSKYTRSKVKKALPSDFNYILDELLNIESKQLNKEKYYNEIVDTIVELERADRFIVAI
CGLVQKLAVDILHIMGDIYDRGPGPHLIMDELMKHSNVDIQWGNHDILWMGAALGHQTMI
AEVLRIALRYSNVECLEEGYGINLLPLGSLAMTVYKDDPCKEFMPKVSNEQFYEEKDKLL
IARMHKAIAIIQFKLEGQLIKRKEEFKRTDRLLLDMVDYERGVLTIDGVEYPLTSCNFPT
IDSNNPYVLTKYEKEVIDKLSSYFKNSEKLQKHIYYFYTNGSLYLKYNGNLLYHGCILLD
EKGDYLNAFIEGKKYKGVELLDKYEELARRAYFTRKESDIDWLWYLWTGRKSPMFAKEKM
ATFERYFTTDKKLHEEKLNPYFKYREDESICRKILESFDLDPDSGHIITGHTPVKVKKGE
SPLKANGKLLVIDGGMSRAYQNTTGIAGYTLMYNSWGLRLVSHHPFTSEDEIVREGVKIN
SNIDVLQKTNRKTVGDTDIGRKLLSQIDDLKELMTVYRSGQIQERRKKL
NT seq 1950 nt NT seq  +upstreamnt  +downstreamnt
atgagagatttggattatttaaaacttttatcgaaacagtaccctagcgttgcagatgta
gcaaatgagattataaaccttaaggcgatactaaatttgcctaaggggacagaacatttc
ctaacagatatgcacggagaatatgaggcattttcatatcatctaagaagtgcttcaggt
gttttaaaatttaagatagatgatatttttggacatacactgactatggatgaaaaaaag
aatctggcaactttgataatatatcctgaaaagcgtcttaaatatgttaaaacttcttac
agcggttctatgactgaatggtataaggtaactatttacagacttattactatctgcaaa
gttgtctcatcaaaatatactcgttctaaagtaaaaaaagccttaccctctgattttaat
tatattcttgatgaacttcttaatattgaaagtaaacaactgaataaggaaaaatactat
aatgaaatagttgacacgatagtagaattagagagagccgacaggtttatagtggctata
tgtggattggtacagaagttagcagtagatatacttcatatcatgggagatatatatgac
agaggtcccggtccccatcttataatggatgagcttatgaagcattcaaatgtcgacatt
caatggggaaaccatgatattttatggatgggagccgctttaggacaccagacaatgata
gcagaggtcttgagaatagctcttagatacagcaatgtagaatgtttagaggaggggtac
ggaataaatctccttcctttgggctctttggctatgacagtatataaagatgatccctgc
aaagaattcatgccaaaggtaagcaacgaacagttttacgaagaaaaggacaagcttttg
attgctagaatgcataaagcgatagcaataatacaatttaagctagagggacagttaatc
aagagaaaagaagaatttaagaggacagacaggctacttttggacatggtagactatgaa
cgtggagttctaacaatagacggggtcgagtaccctctaactagctgtaattttcctaca
attgattctaataatccatatgtacttacaaaatatgaaaaagaagtaattgataagttg
tcttcttattttaaaaacagtgaaaaactgcaaaaacacatatattatttttatacaaat
ggaagtctttacttgaaatataacgggaatttattgtatcacgggtgtatactcttagat
gaaaaaggagactacctcaatgcttttatagagggtaaaaagtataaaggtgtggaactt
ttagataaatatgaagagttggccagaagggcatattttacaagaaaagaaagtgatata
gactggttgtggtatttatggactggtagaaagtcgcctatgttcgccaaggaaaaaatg
gcaacttttgaaaggtattttactacagacaaaaaacttcatgaagaaaaactaaatcca
tatttcaaatacagagaagatgaatccatctgcagaaaaatacttgaaagttttgatctc
gatcctgatagtggacatataataactggtcatactcctgtgaaggtgaaaaaaggagag
agccctctaaaggctaatggaaaacttttggttatagatggtggtatgtctagagcatac
caaaataccacgggaatcgctgggtatactctgatgtataattcttggggactgagactg
gtatcccatcaccctttcacatctgaagatgaaatagtaagagaaggggtaaaaattaat
tctaatatcgatgttttacaaaagacaaatagaaaaacagtgggagacactgatataggt
agaaaattactttctcagattgatgatctaaaagaacttatgacggtatacagaagtggt
cagatacaagagcgaagaaaaaagttataa

DBGET integrated database retrieval system