KEGG   Ilyobacter polytropus: Ilyop_1230Help
Entry
Ilyop_1230        CDS       T01337                                 

Definition
alcohol dehydrogenase AdhE (EC:1.1.1.1 1.2.1.10)
Orthology
K04072  
acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
ipo  Ilyobacter polytropus
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:ipo00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Ilyop_1230
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Ilyop_1230
   00620 Pyruvate metabolism
    Ilyop_1230
   00650 Butanoate metabolism
    Ilyop_1230
  Lipid metabolism
   00071 Fatty acid degradation
    Ilyop_1230
  Amino acid metabolism
   00350 Tyrosine metabolism
    Ilyop_1230
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Ilyop_1230
   00626 Naphthalene degradation
    Ilyop_1230
Enzymes [BR:ipo01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Ilyop_1230
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     Ilyop_1230
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1335277..1337922
Genome map
AA seq 881 aa AA seqDB search
MTIEQTIVNVRLAQKQYSTFTQEQVDKVFREASLAANASRIKLAKMAFEETGMGIVEDKV
IKNHFASEYIYNQYKDVKTCGIIEKDASYGITKIAEPIGVIAGIVPTTNPTSTAIFKALI
ALKTRNAIIFSPHPRAKKATVEAARIIRDAAVKAGAPENIVGWIEEPSIEASNTLMRSAD
LILATGGPGMVKAAYSSGVPAIGVGAGNTPVIIDDTAHIKMAVNSILLSKTFDNGVICAS
EQAVIATENIYEEVKKELADRGAYILKGDEISKVGKTIVIDGHLNGDIVGQSAYKIAKMA
GVDVPENAKVLVGEVESVELEEPFSHEKLSPVLALYKTKSFDESLKKADRLIELGGMGHT
SVLYVDELDGVDKISKFSNTMKTGRTLINMPAAQGAIGDVFNFKLAPSLTLGCGSWGGNA
VSENVGVKHLINIKTVAERRENMLWFRVPEKVYFKYGSLPVALNELQGKKKAVIVTDSVL
ASLGYTDHITKVLEDIGVDFRIFSDVQADPTLSIVKKGAEMMQSYQPDIIIALGGGSPMD
AAKIMWVMYEHPEVDFQDLAMTFMDIRKRIVEFPKMGGKAKFWAVTTSAGTGSEVTPFAV
ITDDKTGIKYPLADYELTPDVAVVDPQLMLSMPAGLTAASGIDVMTHAIEAYASILASDF
TNPLALEAMRLTLKYLPESVKGGAKAKKAKEKMANASCAAGMAFSNAFLGVCHSMAHKLG
AAFHLPHGTANALLLDEVIRFNATDKPLKMAGFAQYKYPNAKSRYAKAADYLGLTKGNEN
PEEKTKLLRAAIRNLKEEIGIKATIADYGISEQEFLGKLDQMVEDAFDDQCTGANPRYPL
MEELREMYLRAYYGVEKFNEINNLKVTKEKTKEKAHEKKAQ
NT seq 2646 nt NT seq  +upstreamnt  +downstreamnt
atgacaatcgaacaaactatcgtaaatgtaagattagctcaaaaacaatactcaactttt
actcaggaacaggtggacaaagtttttagagaagcttctctggctgccaacgcttcaaga
atcaaacttgctaaaatggcttttgaagaaactggaatgggaatagtagaggataaggtt
ataaaaaaccacttcgcctctgaatatatctacaaccaatataaagacgttaaaacttgc
ggaataatagaaaaagatgcttcttatggaataactaaaatagctgaacctatcggggtt
atcgctggaatagttcccactacaaaccctacttctacagctatattcaaagctcttatt
gcattaaaaactagaaatgctattattttctctccacacccgagagcaaaaaaagcaact
gttgaagctgctagaataataagagatgctgctgtaaaggcaggggctcctgaaaatatc
gtaggatggatagaagagccttctatcgaagcttcaaatacacttatgagatctgctgac
cttatccttgcaacaggtggacctggaatggtaaaagcggcttactcttctggtgtaccg
gctataggggttggagcaggaaacactcctgtaatcattgatgatactgcacatattaaa
atggctgtaaactcaatacttctttctaaaacttttgataacggagtaatctgtgcttct
gagcaggctgtaattgcaacagaaaacatctatgaagaagttaaaaaagaattagcagac
agaggagcatacatactaaagggagacgaaatttctaaagttggaaaaacaatagtaatt
gacggtcacttaaatggagatattgtaggacaatctgcatataaaattgcaaagatggca
ggagtagatgtccctgaaaatgcaaaagtacttgtaggagaagtggaatcagtagaatta
gaagagccattctcacacgaaaaactttctcctgtattagctctttataaaacaaagtct
ttcgatgaatctttaaagaaagccgacagattaatagaattaggtggaatgggacatact
tctgttctttatgttgatgagctagacggagttgataaaatatctaaattctcaaacaca
atgaagacaggaagaactcttataaacatgcctgcagcccaaggtgctatcggagatgta
tttaactttaaactagctccttctcttactcttggttgcggaagctggggaggaaatgca
gtttctgaaaacgtaggagttaaacatcttataaacataaaaactgtagctgaaaggaga
gaaaacatgctttggttcagagttcctgagaaagtttactttaaatacggttctcttcct
gttgcattaaatgagcttcaagggaagaaaaaagctgtcattgttacagattcagtgcta
gcttcactcggatatacagatcatatcacaaaggttttagaagatatcggggtagacttt
agaatattctctgatgtacaagctgaccctactttatctatagtaaaaaaaggtgctgaa
atgatgcaaagttatcagcctgacataatcatagcccttggtggaggatctcctatggac
gccgccaaaattatgtgggtaatgtatgagcatcctgaagtagatttccaagatcttgct
atgacatttatggatatcagaaagagaatagttgaattccctaaaatgggtggaaaggct
aaattctgggctgtaactacatctgcaggaaccggttctgaagttactccgtttgcagta
atcacagacgacaagacaggaatcaagtatccattggcagattatgaacttactcctgat
gtagctgtagttgatccacaattaatgctttctatgcctgcgggtcttactgctgcatct
ggtatagacgtaatgactcacgctattgaagcctatgcctctatacttgcatctgacttt
acaaaccctctagccttagaagctatgagacttacattaaaatatcttcctgaatcagta
aagggcggagcaaaagctaaaaaagctaaggaaaaaatggcaaatgcatcttgtgctgcc
ggtatggcattctcaaatgcattcctaggtgtatgtcactcaatggctcataaactaggt
gctgcattccaccttcctcacggaactgcaaatgctcttttattagatgaggtaatcaga
tttaacgctactgacaaaccgttaaaaatggctggtttcgcacaatataaatatccaaat
gctaagagtagatatgcaaaagctgctgactacttaggtcttacaaaaggaaatgaaaat
cctgaagagaaaactaaacttctaagagctgctataagaaatcttaaagaagagatcggt
ataaaggcaactatcgctgactacggaatctctgaacaggaattcttaggaaaacttgat
caaatggttgaagatgcatttgacgaccagtgtacaggtgcaaaccctagatatcctctt
atggaagaacttagagagatgtacctaagagcttactacggagttgaaaaattcaacgaa
ataaacaaccttaaagttacaaaagaaaaaactaaagaaaaagctcacgaaaaaaaagct
caataa

DBGET integrated database retrieval system