KEGG   Ilyobacter polytropus: Ilyop_1517Help
Entry
Ilyop_1517        CDS       T01337                                 

Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
ipo  Ilyobacter polytropus
Pathway
ipo00010  Glycolysis / Gluconeogenesis
ipo00051  Fructose and mannose metabolism
ipo00562  Inositol phosphate metabolism
ipo01100  Metabolic pathways
ipo01110  Biosynthesis of secondary metabolites
ipo01120  Microbial metabolism in diverse environments
ipo01130  Biosynthesis of antibiotics
ipo01200  Carbon metabolism
ipo01230  Biosynthesis of amino acids
Module
ipo_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
ipo_M00002  Glycolysis, core module involving three-carbon compounds
ipo_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:ipo00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Ilyop_1517
   00051 Fructose and mannose metabolism
    Ilyop_1517
   00562 Inositol phosphate metabolism
    Ilyop_1517
Enzymes [BR:ipo01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Ilyop_1517
Exosome [BR:ipo04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Ilyop_1517
  Exosomal proteins of bladder cancer cells
   Ilyop_1517
  Exosomal proteins of melanoma cells
   Ilyop_1517
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: ADO83297
JGI: Ilyop_1517
UniProt: E3H866
Position
complement(1632213..1632971)
Genome map
AA seq 252 aa AA seqDB search
MRKTIVAGNWKMNKTNSESVEMLTELKELVKGMNNVGIVLGVPFTALSDAVKAVEGSGIE
IAAQNMNPNESGAFTGEIAPSMLTSIGVKYVILGHSERREYYKECDEFINEKVKAALKNG
LTPILCIGEKLEDRESGKTDEVNEKQLRGGMAGLTAEEAAKVVVAYEPVWAIGTGKTATP
EMAQETHKAIRNFLADMFGAEVAEEITIQYGGSMKPANAAELMGQTDIDGGLVGGASLEA
SSFSKIVEAGVK
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaaacaatcgtagcaggaaactggaaaatgaacaaaacaaactcagagtcggtg
gagatgctgacagaattaaaagaattagtaaagggaatgaataatgtaggaatagtttta
ggtgtaccttttaccgcactttcagacgcagtgaaggctgtagagggatcaggcatagaa
atagctgcacagaacatgaatccaaatgaatcaggtgcatttacaggagagatagctcca
agtatgttaacttctataggggttaaatatgtgattctagggcattctgaaagaagagaa
tattacaaagaatgtgatgaattcataaatgaaaaggtaaaggctgctcttaaaaacgga
ctaactcctattctttgtataggggaaaaattagaagatagagaaagtggaaagactgat
gaagttaatgaaaaacaattaagaggcggaatggctggtttgacagcggaagaagctgca
aaagttgtagttgcttatgaaccagtatgggctataggaactggtaaaacagctactcct
gagatggctcaggaaactcataaggccataagaaacttcttagctgatatgtttggagca
gaagtagcagaagagataacaattcagtatggaggatctatgaagcctgcaaatgctgct
gaacttatgggtcagactgacatagacggaggacttgtaggtggagcatcattagaagct
tctagtttttctaaaatagtagaagcaggagtaaaataa

DBGET integrated database retrieval system