KEGG   Ilyobacter polytropus: Ilyop_1741Help
Entry
Ilyop_1741        CDS       T01337                                 

Definition
glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
ipo  Ilyobacter polytropus
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:ipo00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1866684..1868195)
Genome map
AA seq 503 aa AA seqDB search
MDKKYVIALDQGTTSSRAIVFDKDGNEVGVSQKEFTQIYPKAGWVEHDPMEIWASQSSVV
TEVIAKTGITNDEIAALGITNQRETTIVWDKNTGKPVYNAIVWQCRRTANICDELKSRGL
EEYVRHNTGLVIDAYFSGTKVKWILDNVEGAREKAEKGDLLFGTVDTWLIWKLTNGKVHV
TDYTNASRTMLFNIRDLKWDEKMLEELNIPKSMLPEVKNSSEVYGQANLGGVGGTGGIRV
PIAGAAGDQQSALFGQACFEKGEAKNTYGTGCFLLMNTGENAVESKNGLLTTIAIGIDNK
VEYALEGSVFVGGASVQWLRDELRLINDAADTEYFAKKVKDSNGVYVVPAFVGLGSPYWD
MYARGTIVGLTRGANRNHIIRATLESVAYQSRDLIDAMEDDSNIKLAALKVDGGAVKNNF
LMQFQSDILGTDVLRPMVTETTALGAAYLAGLAVGFWKSKEEIRNRWQVETKFDPAIGEE
RKEKLYKGWKKAVERSMAWEEKE
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atggataaaaagtacgtaatcgcattggatcaagggacaacaagctcaagggcaatagtg
tttgataaagacggaaatgaagtaggagtatctcaaaaggagtttactcagatatatcca
aaggcaggatgggtagaacatgatccaatggaaatatgggcaagccagagttcagttgta
acagaggtaatagctaagactggaataacaaatgacgagatagcagctctaggaataaca
aatcaaagagagacaactattgtatgggataaaaataccgggaaacctgtatataatgca
attgtctggcagtgcagaagaactgcaaatatatgtgatgaattgaaatcaagaggttta
gaagagtacgtaagacataatacaggtcttgtaatagatgcctatttctccggaactaaa
gttaagtggattctcgacaacgtagagggtgcgagagaaaaagctgaaaaaggagattta
cttttcggaactgtagatacatggcttatctggaaactgactaacggaaaagttcacgta
acagattatacaaatgcctcaagaactatgttatttaacataagagatcttaagtgggat
gaaaagatgttagaagagctcaacataccaaaatctatgcttcctgaagtgaaaaattcc
agtgaagtatatggtcaggctaacctcggaggagtaggaggaacaggcggaataagagta
ccaatcgcaggagctgcaggagatcagcagtcggcattatttggacaggcttgttttgaa
aagggagaagctaaaaatacatatggtactggatgtttccttcttatgaatacaggggaa
aacgcagtagagtctaaaaacggacttctaacaacaatagcaataggtatagacaacaag
gtagaatatgccttagagggaagtgtatttgtaggaggagcctctgtacaatggcttaga
gatgaactcagacttataaatgacgcagcagacacagagtattttgccaagaaggtaaag
gacagtaacggtgtatatgtagtacctgcctttgtaggtctaggatcaccatactgggat
atgtatgccagaggaacaatagttggtcttacaagaggggctaacagaaatcacataatc
agagcaactctagaatctgtagcttatcaatctagagaccttatagacgcaatggaagat
gactctaacattaaactagcggctctgaaagtagacggaggagcagtaaagaataacttc
ttaatgcagttccaatcagacatactaggaacagacgtgctaagaccaatggtaactgag
acaacagccttaggagcagcttatctggctggacttgctgttggattctggaaaagtaaa
gaagagataagaaacagatggcaggttgaaactaagtttgatccggctataggtgaagaa
cgtaaagagaaattgtacaaaggatggaaaaaggctgtagaaagatcaatggcctgggaa
gaaaaagaatag

DBGET integrated database retrieval system