KEGG   Ilyobacter polytropus: Ilyop_1747Help
Entry
Ilyop_1747        CDS       T01337                                 

Definition
glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
ipo  Ilyobacter polytropus
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ipo00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    Ilyop_1747
Enzymes [BR:ipo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     Ilyop_1747
Exosome [BR:ipo04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Ilyop_1747
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1872933..1874444)
Genome map
AA seq 503 aa AA seqDB search
MDKKYVIALDQGTTSSRAIVFDKDGNEVGVSQKEFTQIYPKAGWVEHDPMEIWASQSSVV
TEVIAKTGITNDEIAALGITNQRETTIVWDKNTGKPVYNAIVWQCRRTANICDELKSRGL
EEYVRHNTGLVIDAYFSGTKVKWILDNVEGAREKAEKGDLLFGTVDTWLIWKLTNGKVHV
TDYTNASRTMLFNIRDLKWDEKMLEELNIPKSMLPEVKNSSEVYGQANLGGVGGTGGIRV
PIAGAAGDQQSALFGQACFEKGEAKNTYGTGCFLLMNTGENAVESKNGLLTTIAIGIDNK
VEYALEGSVFVGGASVQWLRDELRLINDAADTEYFAKKVKDSNGVYVVPAFVGLGSPYWD
MYARGTIVGLTRGANRNHIIRATLESVAYQSRDLIDAMEDDSNIKLAALKVDGGAVKNNF
LMQFQSDILGTDVLRPMVTETTALGAAYLAGLAVGFWKSKEEIRNRWQVETKFDPAIGEE
RKEKLYKGWKKAVERSMAWEEKE
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atggataaaaagtacgtaatcgcattggatcaagggacaacaagctcaagggcaatagtg
tttgataaagacggaaatgaagtaggagtatctcaaaaggagtttactcagatatatcca
aaggcaggatgggtagaacatgatccaatggaaatatgggcaagccagagttcagttgta
acagaggtaatagctaagactggaataacaaatgacgagatagcagctctaggaataaca
aatcaaagagaaacaactattgtatgggataaaaataccgggaaacctgtatataatgca
attgtctggcagtgcagaagaactgcaaatatatgtgatgaattgaaatcaagaggttta
gaagagtacgtaagacataatacaggtcttgtaatagatgcctatttctccggaactaaa
gttaagtggattctcgacaacgtagagggtgcgagagaaaaagctgaaaaaggagattta
cttttcggaactgtagatacatggcttatctggaaactgactaacggaaaagttcacgta
acagattatacaaatgcctcaagaactatgttatttaacataagagatcttaagtgggat
gaaaagatgttagaagagctcaacataccaaaatctatgcttcctgaagtgaaaaattcc
agtgaagtatatggtcaggctaacctcggaggagtaggaggaacaggcggaataagagta
ccaatcgcaggagctgcaggagatcagcagtcggcattatttggacaggcttgttttgaa
aagggagaagctaaaaatacatatggtactggatgtttccttcttatgaatacaggggaa
aacgcagtagagtctaaaaacggacttctaacaacaatagcaataggtatagacaacaag
gtagaatatgccttagagggaagtgtatttgtaggaggagcctctgtacaatggcttaga
gatgaactcagacttataaatgacgcagcagacacagagtattttgccaagaaggtaaag
gacagtaacggtgtatatgtagtacctgcctttgtaggtctaggatcaccatactgggat
atgtatgccagaggaacaatagttggtcttacaagaggggctaacagaaatcacataatc
agagcaactctagaatctgtagcttatcaatctagagaccttatagacgcaatggaagat
gactctaacattaaactagcggctctgaaagtagacggaggagcagtaaagaataacttc
ttaatgcagttccaatcagacatactaggaacagacgtgctaagaccaatggtaactgag
acaacagccttaggagcagcttatctggctggacttgctgttggattctggaaaagtaaa
gaagagataagaaacagatggcaggttgaaactaagtttgatccggctataggtgaagaa
cgtaaagagaaattgtacaaaggatggaaaaaggctgtagaaagatcaatggcctgggaa
gaaaaagaatag

DBGET integrated database retrieval system