KEGG   Ilyobacter polytropus: Ilyop_1779Help
Entry
Ilyop_1779        CDS       T01337                                 

Definition
nicotinamidase (EC:3.5.1.19)
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
ipo  Ilyobacter polytropus
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Nicotinate and nicotinamide metabolism [PATH:ipo00760]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1912625..1913245
Genome map
AA seq 206 aa AA seqDB search
MNKALLIVDVQNDFCEGGSLEVKNSLDIIPVINKLIDKFKQLSYPVIATKDWHPSNHKSF
ASVSGGRIGELGELNGIPQIWWPDHCIQGTKGAELHPDLNTVDTVIHKGSDPEVDSYSGF
FSASGKPTLLEEVLKKQKVDTLYIVGLATDYCVKFTVLDALSLGYKVIVIKDGCQGVNIN
PEDSKLAFFKMKEKGAEIISSTKLEI
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
atgaataaagcacttttgattgttgacgttcaaaatgatttttgtgaaggaggaagttta
gaggtaaagaactccttagatattattcctgttataaataaattgattgataaatttaaa
cagctgtcgtatccggttatagccacaaaagactggcacccttctaaccacaagagcttc
gcttcagtttccggaggtagaatcggcgaattgggagaactaaatggaatacctcagata
tggtggcctgatcactgtattcagggaactaaaggtgcagaacttcatcctgatttaaac
actgttgatacagttatacataagggatccgatcctgaagttgattcttacagcgggttt
ttcagtgcttcaggtaaaccaactcttttagaagaagttttgaaaaaacaaaaagttgat
acactctatatagtgggattagctactgattattgcgttaaatttacggttttagatgcc
ttgtctctgggatacaaagtgatcgtcataaaagatggctgccaaggagtaaatataaat
cctgaagattcaaagcttgctttttttaaaatgaaggaaaaaggagcagaaattatttcc
agcacgaaactcgaaatttaa

DBGET integrated database retrieval system