KEGG   Ilyobacter polytropus: Ilyop_1889Help
Entry
Ilyop_1889        CDS       T01337                                 

Definition
hypothetical protein
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
ipo  Ilyobacter polytropus
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:ipo00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Ilyop_1889
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Ilyop_1889
   00020 Citrate cycle (TCA cycle)
    Ilyop_1889
   00620 Pyruvate metabolism
    Ilyop_1889
Enzymes [BR:ipo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Ilyop_1889
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2019280..2020587
Genome map
AA seq 435 aa AA seqDB search
MYHFKFADIGEGIHEGKLLEWMVSEGDSIKSGDSLFLVETDKVNAEIPSPVKGVVAKLMA
QVGDVIKVGDIIVDIEEEGSLQDTKPQKKELVQESDKPQEEVVKKEKTEEKGAGVVGEIT
VSNDLIPSFSQEKSEKPSLRKKVLATPVARKMAKDLGVDITLVKGSGTMGRVMKEDIKNF
HSSDNKKKETNQNISALTSSQSGSIEEVELSGIRKTISKSMTLSKQIIPHTVLMDEFDVT
SLVEFRKEAKQEALLQGVKLTYMPFIIKAVTIALKEFPLFNCVYDHENEKLLFKKFYNIG
VATDTPEGLMVPVIKNTDHMGLLETAKEMNRLVEASKNKKLTLDDIKDGTFSITNYGAIG
SLFGTPIIKHPQVAILGIGRVNKKPVVSEEGNVEVRDIMPISMAVDHRIIDGADAGRFAE
RLKQLLSNPKLLLMS
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
atgtaccattttaaatttgcagatataggagaaggaatccacgagggaaaactccttgaa
tggatggtcagcgaaggagattctataaaaagcggagattctctttttcttgtggaaact
gataaggtcaatgctgagattccatctcctgtaaaaggtgttgttgccaaacttatggcc
caggtgggggatgttataaaagttggggatattatcgtagatatagaggaagaaggatct
ttgcaggacaccaaacctcaaaagaaagagcttgttcaagagtctgataaaccccaagaa
gaagttgtaaaaaaagaaaaaacagaagaaaaaggtgcaggtgtcgtaggggagataaca
gtttctaacgatcttatccctagcttcagccaagaaaaatcagaaaaaccttctctcaga
aaaaaagttttggccactccggtagcgagaaaaatggcaaaagatttaggagtggacata
accttagtaaagggaagcggtacaatgggaagagttatgaaagaagatatcaaaaatttt
cactcttcagacaataaaaagaaagaaacaaatcaaaatatttctgctttaacttctagt
cagtcaggttctattgaggaagtggaactttcaggcataagaaaaacaatatcaaagtca
atgacactttcaaaacaaataataccacacaccgtactcatggatgagtttgacgtgact
tctcttgtggagttcagaaaggaagctaaacaagaagctcttcttcaaggggtaaaactt
acatacatgccttttattataaaagctgtcaccatcgcactgaaagagtttcctttattt
aactgcgtatatgatcatgaaaatgaaaagctgctatttaagaaattctacaatataggt
gtggctacagatacccctgagggtctcatggtccctgtgattaaaaatacagaccatatg
ggtctattagagacggcaaaagaaatgaacaggcttgtagaggcctctaaaaataaaaag
cttacccttgatgatataaaagacgggacattttccattacaaattacggagctataggt
tctttatttggtactcctataataaagcatcctcaggttgccatccttgggataggtaga
gttaataaaaagcccgtggtttctgaagaagggaatgttgaagtaagagatataatgcca
atatctatggctgttgatcacagaattatagacggggctgatgcaggtcgttttgcagaa
agactcaagcaacttctttctaacccaaaacttcttctcatgagttag

DBGET integrated database retrieval system