KEGG   Ilyobacter polytropus: Ilyop_2000Help
Entry
Ilyop_2000        CDS       T01337                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K21071  ATP-dependent phosphofructokinase / diphosphate-dependent phosphofructokinase [EC:2.7.1.11 2.7.1.90]
Organism
ipo  Ilyobacter polytropus
Pathway
ipo00010  Glycolysis / Gluconeogenesis
ipo00030  Pentose phosphate pathway
ipo00051  Fructose and mannose metabolism
ipo00052  Galactose metabolism
ipo00680  Methane metabolism
ipo01100  Metabolic pathways
ipo01110  Biosynthesis of secondary metabolites
ipo01120  Microbial metabolism in diverse environments
ipo01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:ipo00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Ilyop_2000
   00030 Pentose phosphate pathway
    Ilyop_2000
   00051 Fructose and mannose metabolism
    Ilyop_2000
   00052 Galactose metabolism
    Ilyop_2000
  Energy metabolism
   00680 Methane metabolism
    Ilyop_2000
Enzymes [BR:ipo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Ilyop_2000
    2.7.1.90  diphosphate---fructose-6-phosphate 1-phosphotransferase
     Ilyop_2000
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase UPF0261 Peripla_BP_1
Motif
Other DBs
NCBI-ProteinID: ADO83771
JGI: Ilyop_2000
UniProt: E3HBF6
Position
pILYOP01:63454..64551
Genome map
AA seq 365 aa AA seqDB search
MKKRVLVVTGGGDCPGLNAVIRAIVKRASQEKDWEVVGSIQSFNGVLKEPEEIVILDKKA
VAGIHFRGGTIIGTTNKGGPFAWPVKKGDGTWTTEDRSDKMIEKLKELGIEAVISIGGDG
SQKISYELYKKGLNIVGVPKTIDNDLFSTDYTFGFQTAVQIATESVDKLVTTAASHNRVL
IMEVMGRDAGWIALHSSVGGGADVCIIPEIPYDPVKIVKRLKERFDNGKGFALIVVAEGA
KRVGGEVYSRKSNEAGYENPMLGGVAYKLADELKKAGCEEDIRVTVLGHLQRGGTPVAFD
RVLATEFGVKAFELVLNKEYGKMVSVKNSTITSVPIEEAISNYKFVGKNSYLVHTGRSVG
ICFGD
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaagagtgttggtagtgacaggcggtggagattgccccggactaaatgcagtg
ataagagcaattgtaaaaagggcctctcaggagaaagattgggaagttgtcggcagtata
cagtcatttaacggggttttaaaagagcctgaagagatagttatattagacaagaaggct
gttgcagggatacatttcagaggaggaacaataataggtactacaaacaaaggaggacct
tttgcatggcctgtaaaaaaaggggatgggacatggacaactgaggacagatcagataag
atgattgaaaaattgaaagagttgggtatagaggcggtaataagtatagggggggatggt
tcacaaaagatatcatatgaactctataaaaaaggactgaacatagtaggagttccaaag
actattgacaatgaccttttctctacagattatacatttggctttcagactgctgtgcaa
attgccacagaatcggttgataaactggtaacaacggctgctagccacaacagagtgctt
ataatggaagtaatgggaagagatgcaggttggatagcccttcattcctctgtaggagga
ggagcagatgtgtgtattatacctgagataccatatgatccggtcaaaattgtaaagaga
ttaaaggaaaggtttgataatgggaaagggtttgcacttatcgttgtagcagagggagct
aaaagagtcggtggtgaggtatacagcaggaaaagcaatgaagctggctatgaaaacccc
atgctaggtggtgtggcctataaactggcagatgaactgaaaaaagcaggatgtgaggaa
gatataagagttactgtactaggtcatcttcagagaggtgggacacctgtggcctttgac
agggttcttgccactgagtttggtgtaaaggcatttgaattggttctaaataaggagtat
ggcaagatggtatcagtaaaaaattctacaataacatctgtacctatcgaggaagccata
tcaaattataaatttgtaggcaaaaattcctatttagtgcacactggaaggtctgtagga
atatgttttggagattga

DBGET integrated database retrieval system