KEGG   Ilyobacter polytropus: Ilyop_2000Help
Entry
Ilyop_2000        CDS       T01337                                 

Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
ipo  Ilyobacter polytropus
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Class
Metabolism; Overview; Carbon metabolism [PATH:ipo01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:ipo01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:ipo00010]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:ipo00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:ipo00051]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:ipo00052]
Metabolism; Energy metabolism; Methane metabolism [PATH:ipo00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
pILYOP01:63454..64551
Genome map
AA seq 365 aa AA seqDB search
MKKRVLVVTGGGDCPGLNAVIRAIVKRASQEKDWEVVGSIQSFNGVLKEPEEIVILDKKA
VAGIHFRGGTIIGTTNKGGPFAWPVKKGDGTWTTEDRSDKMIEKLKELGIEAVISIGGDG
SQKISYELYKKGLNIVGVPKTIDNDLFSTDYTFGFQTAVQIATESVDKLVTTAASHNRVL
IMEVMGRDAGWIALHSSVGGGADVCIIPEIPYDPVKIVKRLKERFDNGKGFALIVVAEGA
KRVGGEVYSRKSNEAGYENPMLGGVAYKLADELKKAGCEEDIRVTVLGHLQRGGTPVAFD
RVLATEFGVKAFELVLNKEYGKMVSVKNSTITSVPIEEAISNYKFVGKNSYLVHTGRSVG
ICFGD
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaagagtgttggtagtgacaggcggtggagattgccccggactaaatgcagtg
ataagagcaattgtaaaaagggcctctcaggagaaagattgggaagttgtcggcagtata
cagtcatttaacggggttttaaaagagcctgaagagatagttatattagacaagaaggct
gttgcagggatacatttcagaggaggaacaataataggtactacaaacaaaggaggacct
tttgcatggcctgtaaaaaaaggggatgggacatggacaactgaggacagatcagataag
atgattgaaaaattgaaagagttgggtatagaggcggtaataagtatagggggggatggt
tcacaaaagatatcatatgaactctataaaaaaggactgaacatagtaggagttccaaag
actattgacaatgaccttttctctacagattatacatttggctttcagactgctgtgcaa
attgccacagaatcggttgataaactggtaacaacggctgctagccacaacagagtgctt
ataatggaagtaatgggaagagatgcaggttggatagcccttcattcctctgtaggagga
ggagcagatgtgtgtattatacctgagataccatatgatccggtcaaaattgtaaagaga
ttaaaggaaaggtttgataatgggaaagggtttgcacttatcgttgtagcagagggagct
aaaagagtcggtggtgaggtatacagcaggaaaagcaatgaagctggctatgaaaacccc
atgctaggtggtgtggcctataaactggcagatgaactgaaaaaagcaggatgtgaggaa
gatataagagttactgtactaggtcatcttcagagaggtgggacacctgtggcctttgac
agggttcttgccactgagtttggtgtaaaggcatttgaattggttctaaataaggagtat
ggcaagatggtatcagtaaaaaattctacaataacatctgtacctatcgaggaagccata
tcaaattataaatttgtaggcaaaaattcctatttagtgcacactggaaggtctgtagga
atatgttttggagattga

DBGET integrated database retrieval system