KEGG   Ilyobacter polytropus: Ilyop_2000Help
Entry
Ilyop_2000        CDS       T01337                                 

Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
ipo  Ilyobacter polytropus
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:ipo00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Ilyop_2000
   01230 Biosynthesis of amino acids
    Ilyop_2000
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Ilyop_2000
   00030 Pentose phosphate pathway
    Ilyop_2000
   00051 Fructose and mannose metabolism
    Ilyop_2000
   00052 Galactose metabolism
    Ilyop_2000
  Energy metabolism
   00680 Methane metabolism
    Ilyop_2000
Enzymes [BR:ipo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Ilyop_2000
Protein phosphatases and associated proteins [BR:ipo01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Ilyop_2000
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
pILYOP01:63454..64551
Genome map
AA seq 365 aa AA seqDB search
MKKRVLVVTGGGDCPGLNAVIRAIVKRASQEKDWEVVGSIQSFNGVLKEPEEIVILDKKA
VAGIHFRGGTIIGTTNKGGPFAWPVKKGDGTWTTEDRSDKMIEKLKELGIEAVISIGGDG
SQKISYELYKKGLNIVGVPKTIDNDLFSTDYTFGFQTAVQIATESVDKLVTTAASHNRVL
IMEVMGRDAGWIALHSSVGGGADVCIIPEIPYDPVKIVKRLKERFDNGKGFALIVVAEGA
KRVGGEVYSRKSNEAGYENPMLGGVAYKLADELKKAGCEEDIRVTVLGHLQRGGTPVAFD
RVLATEFGVKAFELVLNKEYGKMVSVKNSTITSVPIEEAISNYKFVGKNSYLVHTGRSVG
ICFGD
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaagagtgttggtagtgacaggcggtggagattgccccggactaaatgcagtg
ataagagcaattgtaaaaagggcctctcaggagaaagattgggaagttgtcggcagtata
cagtcatttaacggggttttaaaagagcctgaagagatagttatattagacaagaaggct
gttgcagggatacatttcagaggaggaacaataataggtactacaaacaaaggaggacct
tttgcatggcctgtaaaaaaaggggatgggacatggacaactgaggacagatcagataag
atgattgaaaaattgaaagagttgggtatagaggcggtaataagtatagggggggatggt
tcacaaaagatatcatatgaactctataaaaaaggactgaacatagtaggagttccaaag
actattgacaatgaccttttctctacagattatacatttggctttcagactgctgtgcaa
attgccacagaatcggttgataaactggtaacaacggctgctagccacaacagagtgctt
ataatggaagtaatgggaagagatgcaggttggatagcccttcattcctctgtaggagga
ggagcagatgtgtgtattatacctgagataccatatgatccggtcaaaattgtaaagaga
ttaaaggaaaggtttgataatgggaaagggtttgcacttatcgttgtagcagagggagct
aaaagagtcggtggtgaggtatacagcaggaaaagcaatgaagctggctatgaaaacccc
atgctaggtggtgtggcctataaactggcagatgaactgaaaaaagcaggatgtgaggaa
gatataagagttactgtactaggtcatcttcagagaggtgggacacctgtggcctttgac
agggttcttgccactgagtttggtgtaaaggcatttgaattggttctaaataaggagtat
ggcaagatggtatcagtaaaaaattctacaataacatctgtacctatcgaggaagccata
tcaaattataaatttgtaggcaaaaattcctatttagtgcacactggaaggtctgtagga
atatgttttggagattga

DBGET integrated database retrieval system