KEGG   Ilyobacter polytropus: Ilyop_2009Help
Entry
Ilyop_2009        CDS       T01337                                 

Definition
asparagine synthase (EC:6.3.5.4)
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
ipo  Ilyobacter polytropus
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ipo00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Ilyop_2009
Enzymes [BR:ipo01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     Ilyop_2009
Peptidases [BR:ipo01002]
 Cysteine Peptidases
  Family C44
   Ilyop_2009
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
pILYOP01:76954..78534
Genome map
AA seq 526 aa AA seqDB search
MCGIMYYSGKEAELLGFEKSFERIVYRGPDSTEILKDKGVWGFHRLSIMDLSNSGMQPFM
LDGSISICNGEIYNFRKIKEDLQDKYKFHSDSDCEVLIPLYKEMGVEMFKYLDAEYAMVM
YDAGADEVIAARDPIGIRPLFYGYSKTTKEIAFASEAKGLTDFCEDVAAFPPGHYYKGGE
FICYRDMTKYTQFIDGDLEEITEGIRERLEAGIIKRLDSDAPVGYLLSGGLDSSLVCAIA
QRNLEKPLKTFAIGMEKDPIDLKYAKEVAEYLGTEHTEVTISEKDVLDNLKHVIYCLETW
DITTIRASMGMYLICKYIRANTDIKVLLTGEISDEIFGYKYTDFAPSGEEFQKEAEKRLR
EIYMYDVLRADRCISANSLEARVPFGDLDFVDYVMGINPEKKLNTYNKGKYLLRKAFEGG
EYLPKDILYREKAAFSDAVGHSLVDCIKAFADEKYSDEDVEKAKEKYAYGTPFTKESLLY
RDIFEEFFPGKAEWIKDFWMPNKEWEGCNVDDPSARVLSNYGDSGK
NT seq 1581 nt NT seq  +upstreamnt  +downstreamnt
atgtgtggaatcatgtattattcaggtaaagaagcggaactattaggatttgagaaaagt
tttgaaagaattgtgtatagaggacctgactctacagaaatactaaaagacaaaggggta
tggggatttcacagattatcaataatggatcttagcaacagcggaatgcagccttttatg
ctagacggaagtatttctatatgtaacggtgagatatacaactttagaaaaataaaagag
gaccttcaagataaatataaatttcactcagatagtgattgtgaagtactgattccgttg
tataaggaaatgggtgtagagatgtttaaatatctagatgcagaatacgccatggttatg
tatgatgccggagctgacgaagtaatagctgctagagacccgatcgggataagaccactt
ttttacggttattcaaaaactaccaaagaaatagcatttgcaagtgaggcaaaaggctta
actgatttttgtgaagatgtagctgcatttcctccaggacattactataaaggtggagaa
ttcatatgctacagagatatgacaaagtatacgcaatttatcgacggagaccttgaagag
ataacagaaggtataagagaaagacttgaagcagggataataaagagattagattctgat
gcaccagtcgggtacctattgagtggaggtttagattcaagtttagtttgtgcaattgct
cagagaaatcttgaaaagcctttaaagacttttgcaatagggatggaaaaggatcctata
gatcttaaatatgccaaagaggtagctgaatacctgggaactgagcatacagaggtaact
atcagcgagaaagatgttttagataacttaaagcatgtaatatactgtcttgagacttgg
gatataacaactattagagcaagtatgggaatgtaccttatttgtaaatatataagagca
aatactgatatcaaagttctattgactggtgaaatcagtgacgaaatatttggatataaa
tatacagattttgcaccaagtggagaagagttccaaaaagaagcggaaaaaagacttaga
gagatctatatgtatgacgtactaagagctgacagatgtatatcagcaaactctctagag
gctagagtaccttttggtgacttagattttgtagactatgtaatggggatcaatcctgaa
aaaaaattaaatacatataacaaaggtaaataccttcttagaaaggctttcgaaggtgga
gaataccttccgaaagacattttatacagagaaaaagcagcctttagtgacgctgtagga
cactcattagttgactgtatcaaggcatttgctgatgaaaagtattctgatgaagatgta
gaaaaggcaaaagaaaaatatgcttatgggactccatttacaaaagaatcactgctatac
agagatatctttgaagagttcttccctggtaaagcagagtggataaaagacttctggatg
ccaaataaagagtgggaaggttgtaacgtagacgaccctagtgcaagagtattatcaaac
tatggtgacagtggaaagtaa

  All links  
No link information was found.   
DBGET integrated database retrieval system