KEGG   Ilyobacter polytropus: Ilyop_2073Help
Entry
Ilyop_2073        CDS       T01337                                 

Definition
type III site-specific deoxyribonuclease (EC:3.1.21.5)
Orthology
K01156  
type III restriction enzyme [EC:3.1.21.5]
Organism
ipo  Ilyobacter polytropus
Brite
Enzymes [BR:ipo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.21  Endodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.21.5  type III site-specific deoxyribonuclease
     Ilyop_2073
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
pILYOP01:complement(131625..134552)
Genome map
AA seq 975 aa AA seqDB search
MSKHLNFENNLKHQNDAIESIVDVFRDAGIYETTPHSNYNLAKDRDVIDSNIERIRGEKK
LSTLKKEYKEGDPLILDIHMETGTGKTYTYTKTIFELNREYGLNKFIVVVPTLSIKAGTV
NFLKSDACRLHFNSIYKKDINCLVVDSGNKKTTAKRPFPPKVKEYIEGSKMDKNSIYVLV
INQGMINSPTIQEEKYDVTLFDRFSCCLDGISSTKPVIIIDEPHKFKSDKKTWKNLMNFN
PQFLIRYGATFDKKYYDLVYSLDAIKAFNNDLVKGIVVNIEENKDGKNESIVLNDNDGKE
AKFIYINELGKKQTFTLSKKDDFSVVHSEMKGLTIEAINKTRALLSNGIEMKKKDKLNPY
SYSEILQEKMIREAIEKHFDIEEENMTKVNSPRIKTMSLFFIDSIESYRNQEDSSKEHIR
IFFEQELERVIKSRIERTNNLEYKKYLEDSLKDIRNCHGGYFSKDNSGSDEKIEKEVNEI
LHDKESLLDLDNPRRFIFSKWTLREGWDNPNIFVICKLRGSGSETNKLQEVGRGLRIPVN
EYMNRVTDKEHYLHYFVDFEEKDFVENLQKEINSGSLFDEQPKVLTDELLKEISKTYNKE
DDDVFDELKTLKIIDRKQNFLDQGFERIKEIYPLVFEQLKKNKVRSSKDGDKKVTLRQEK
YLEFKKLWEELNKKVLIKYDFKSNQEQQELLNNMILEFWGNGLFENSGFKLKVHKMEKGD
KIDFIEEKSVSYKIQNMSHLTYKEFLLELEKIMKVPLVMIHNMFLYLKENSSIKIKDGIS
KNNFNLNNYLNRTTIREIQKYYRDYLIENSLKNMFISYDEVSTNIHPTTLTDEIGKAKQS
ICSSEVGVNNSIEKVDSNYLFNELYFDSEIEKENIIEHISEVVVFSKIPKNSIKIPVVAG
GTYSPDFAYVVRYKDGKETLNLVVESKGKDEIGLSTEEKMKIKCVEKLFAGNLNIKFKPQ
FKRDEMSKIIRNITQ
NT seq 2928 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaacaccttaattttgaaaataatctgaaacatcaaaatgatgccatagaatct
atcgtggatgtctttagagatgcagggatatatgagactactccgcatagtaactataat
ttggcaaaggacagagatgtcatagattcaaatattgagaggataagaggagaaaagaag
cttagcactctcaaaaaagagtataaggagggagatcctctgatcttggatattcatatg
gaaacaggaactgggaaaacctatacctatactaaaactatttttgaactgaacagagaa
tatggattaaacaagtttattgttgttgtccccaccctatcaataaaagccgggacagtt
aattttttaaagagtgatgcttgcagacttcactttaacagtatttataaaaaagatatc
aactgtctagttgtagatagtggcaataaaaagaccacggctaaaagacctttccctcca
aaggtaaaggagtacatagaaggttcaaagatggataaaaacagtatttatgtactggta
attaaccaggggatgataaatagccctacaattcaagaagagaaatatgatgttacatta
tttgacagattttcctgctgcttggacggtatatcatcaactaagcctgtgatcataata
gatgaacctcataaatttaaaagtgataaaaaaacatggaaaaatctaatgaattttaat
ccacagtttcttattaggtacggagcgacctttgataaaaaatattatgatctggtttac
tctctcgatgctataaaagcctttaacaacgatcttgttaagggaatagttgtaaatatc
gaggaaaacaaagacggaaaaaatgaatctatagttttaaatgataacgacggaaaagaa
gccaagtttatttatattaatgaactgggtaaaaagcagacttttactcttagtaaaaaa
gatgacttttcagttgtccattctgaaatgaagggtctcactattgaagctattaataaa
actagagctcttttgtctaacgggatagagatgaagaaaaaagataaacttaacccttat
tcttacagcgaaatattacaggaaaagatgataagagaggctatagagaaacactttgat
atagaagaagaaaatatgactaaggtaaattctcctaggataaaaacaatgtctcttttc
tttattgactccatcgaatcctatagaaatcaggaagacagcagtaaggaacatataaga
atattttttgaacaggaactggaaagggttataaaatcaagaatagaaagaacaaataat
cttgaatataaaaaatatctagaagatagcttaaaagatataagaaactgtcatggagga
tacttttctaaagataacagtggtagtgatgaaaaaatagagaaagaggtcaacgagata
ctccatgataaggaatccctattagatttggataacccaaggaggtttatattttctaaa
tggaccttaagagaaggctgggacaatcccaatatctttgttatatgtaaactacgtgga
agcggaagtgagacaaataaactccaagaagtaggaagaggattaagaatcccggtaaat
gagtatatgaatagggttaccgataaagaacattatctccattactttgtagattttgaa
gagaaagattttgtagaaaatcttcaaaaagagataaacagcgggtctctttttgacgag
caaccaaaggttttgactgatgaacttcttaaagagatatccaaaacatacaataaagaa
gatgatgatgtttttgatgaacttaaaaccttgaagataattgacagaaaacaaaatttc
ttagatcagggatttgagagaataaaagagatctatcctttagtttttgaacagcttaag
aaaaataaagttagaagcagtaaagatggagataaaaaagtaactttgaggcaggaaaaa
tacttagaatttaaaaaactgtgggaagagctaaataaaaaggtacttataaaatatgac
tttaagagcaaccaagaacagcaagagttgttgaacaatatgattttagaattttggggg
aatggcctttttgaaaacagcggtttcaagttgaaagtacataagatggaaaaaggagat
aaaatagattttatcgaggaaaaaagtgtgtcatataaaattcaaaacatgtctcactta
acctataaagagtttttattagagctggaaaaaataatgaaggttccactcgtcatgatt
cataatatgttcttatatctcaaagagaatagttcaattaaaattaaagatggaatatca
aaaaataatttcaatttgaacaactacctaaacagaactacaattagggaaattcaaaaa
tattatagagattacctaattgaaaattctttgaaaaatatgttcatatcatatgatgag
gtcagtacaaatattcacccaactaccttaaccgatgaaatcggaaaagctaaacaaagt
atctgttcatcagaagtaggagttaataacagcatagaaaaagttgacagcaactacctg
ttcaatgaactctattttgactctgagattgaaaaagaaaatattatagaacatatctca
gaagtggtagttttttctaaaatacctaaaaatagtattaaaattccagtagttgcagga
ggaacctactctccagactttgcttatgtggtgagatataaagatggtaaagaaacttta
aatcttgtagtcgaatctaaaggcaaagacgagataggtttatcaactgaagaaaaaatg
aaaatcaaatgtgttgagaagctttttgctggaaatttaaatattaagtttaagccacaa
tttaaaagggacgagatgagcaaaataattagaaatattacacaatag

DBGET integrated database retrieval system