KEGG   Ilyobacter polytropus: Ilyop_2241Help
Entry
Ilyop_2241        CDS       T01337                                 

Definition
protein-L-isoaspartate O-methyltransferase (EC:2.1.1.77)
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
ipo  Ilyobacter polytropus
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
pILYOP01:327735..328358
Genome map
AA seq 207 aa AA seqDB search
MFESEKSKMIKDHLIGRGIRDARVLKAMSSVPREKFVRERDKLISYADTPLSIGWGQTIS
QPYIVAYMLEVLDIEKENRVLEIGTGSGYEAAILSRLAKEVVTVEIVEELYKDGKRKLEN
LGYENIEVVSGDGYRGYKKKAPYDRIILSAAPTDIPENLVDQLAAKGKLIAPVGGIFQEL
ILLEKDEFGKISKKRLLPVRFVPMVRE
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
atgtttgaatcagaaaaaagcaagatgataaaagatcaccttataggcagaggaataaga
gatgcaagggttctaaaagccatgagcagtgttcctagagaaaagtttgtaagggagagg
gataagttgatctcatatgcagatacacctctttccataggatggggtcagacaatatct
cagccatacatagtggcgtatatgctagaagttttagacatagaaaaagaaaacagggtt
ttagagatagggacgggatcgggatatgaagctgctattttgtcaagactggctaaagag
gttgtgactgtagagatagtggaagaactctataaagatggcaaaagaaaacttgaaaat
ctggggtatgaaaatatagaagtagtaagtggtgacgggtatagaggttataaaaaaaag
gcaccttatgataggataatattatcagcagctccgactgatattcctgaaaatcttgtt
gatcagctggctgcaaagggaaaattaatagctcctgtaggggggatttttcaagagctg
atattactagaaaaagatgaatttgggaagatatcaaaaaaaagacttttacctgttaga
tttgttccgatggtaagagagtga

DBGET integrated database retrieval system