KEGG   Ilyobacter polytropus: Ilyop_2378Help
Entry
Ilyop_2378        CDS       T01337                                 

Definition
uroporphyrinogen-III C-methyltransferase ;uroporphyrinogen-III synthase (EC:2.1.1.107 4.2.1.75)
Orthology
K13542  
uroporphyrinogen III methyltransferase / synthase [EC:2.1.1.107 4.2.1.75]
Organism
ipo  Ilyobacter polytropus
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ipo00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Ilyop_2378
Enzymes [BR:ipo01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.107  uroporphyrinogen-III C-methyltransferase
     Ilyop_2378
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     Ilyop_2378
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
pILYOP01:479830..481302
Genome map
AA seq 490 aa AA seqDB search
MNKGKVYIVGAGPGDLELLSLKAKRCVEEADCIVYDRLINKRILKFAKPDAELIYLGKLN
TEGGVIQDEINKTLVREALKGKVVTRLKGGDPFVFGRGGEEIQEILKDEIPFEVVPGITS
SISVPAYSGIPVTHRGISRSFHVFTGHTMEDGGWHNFDAIAKLKGTLVFLMGVKNLDLIT
GDLIKNGKDPETPVGIIEKGSTSKQRVIRGTLSTIVEIAKKEDVKPPAIIIIGGVVNLRD
EFNWFEKKELFGKKILVTRDEKQAEAMSSVIEKKGGEAVELPLIQIEDQMKDYDYSEIKK
YSCLLFNSQNAVRSFFRYLPDMRLLGDIKIGVVGVKTKEELLKVKLVPDFMPEEYIGELL
AKEACDCTKEEDKILFVTSDISPNNPEEWSAKYKRNFEKLAAYKTVKIKKDKSEVEETLK
GVDIVTFLSSSTVEAFVESLDGNLDGIKGVKFASIGPVTSETMKKLGLSVDIEAKIFTAE
GVLKSIEEAM
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atgaacaaaggtaaggtatatattgtaggagcagggcctggagacttggagcttctatca
ttaaaagctaagagatgcgttgaagaagctgactgtatagtttatgacaggcttataaat
aaaaggattctaaaatttgcaaaacctgatgcagaacttatatacctaggaaagctaaat
acagaaggaggagtgatccaggacgagatcaacaagacccttgtgagagaagctttaaaa
ggtaaagtagtgactaggttaaaaggcggtgacccctttgtatttggtagaggcggtgag
gagatacaggaaatattaaaagatgagattccttttgaagttgttcctggtatcacttct
tctatatctgttcctgcatattctggtatccctgttactcacaggggaatctcaaggtct
tttcatgtgttcacaggtcacacaatggaagacggaggatggcataattttgatgccatt
gccaaactaaagggaactctggttttcttgatgggtgtaaaaaatcttgatcttattaca
ggtgacctcataaaaaacgggaaagaccctgaaacacctgttgggataatagaaaaagga
agtacttctaagcagagagttataagaggaactctttcaactatagttgaaattgccaag
aaagaagatgtaaaacctccagctataattattataggaggcgttgtaaacctacgtgac
gagtttaactggtttgagaaaaaggaactcttcggtaaaaagatacttgtgacaagagat
gaaaaacaggctgaagcaatgagtagtgttatagaaaaaaaaggcggagaagcagtggaa
cttcctcttattcagatagaggatcagatgaaggattatgattattcagagatcaaaaaa
tatagctgtcttctttttaattcgcaaaatgcagtgagaagtttctttaggtatcttcct
gacatgagattattgggcgatataaagataggtgtagtgggagtgaagactaaggaagag
ctgttaaaagtgaagctggttccggactttatgcctgaagagtatattggagaacttctt
gcaaaggaagcttgtgattgtacaaaagaggaagacaaaattttgtttgtaacatctgat
atatctccgaataatccagaggaatggagtgccaaatacaaaagaaactttgaaaaatta
gcggcatataaaacagtaaagataaaaaaagataaaagtgaagtggaagaaactcttaaa
ggggttgatatagttacattcttaagttcttcaactgtagaggcttttgtagaaagcctt
gatggaaatttggacgggataaaaggtgtgaaatttgcatctataggacctgtgacaagt
gagaccatgaaaaagttgggattatctgtggatatagaggccaagatatttacagcagaa
ggagttttaaagtcgattgaggaggctatgtga

DBGET integrated database retrieval system