KEGG   Ilyobacter polytropus: Ilyop_2379Help
Entry
Ilyop_2379        CDS       T01337                                 

Definition
porphobilinogen synthase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
ipo  Ilyobacter polytropus
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ipo00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Ilyop_2379
Enzymes [BR:ipo01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     Ilyop_2379
Exosome [BR:ipo04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Ilyop_2379
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
pILYOP01:481302..482279
Genome map
AA seq 325 aa AA seqDB search
MFKRHRRLRGSQVMRDMVKDLYLDVKDFVYPLFIEEGTGIRQEIQSMPGQYRLSIDMLKP
ELDEIWDLGIRSILIFGIPLEKDPMGKEAYNDLGIVQEAVRFIKKSYPKMLVITDVCMCE
YTSHGHCGILSGPHVLNDETLYYLSKIAVSHAKAGADMVAPSDMMDGRILAMRKALDNEG
FINTPIMSYSVKYASSFYGPFRDAADSSPSFGDRKTYQMDFRSTKEALREAEADLDEGAD
ILIVKPALSYLDVVKRLYRRYDVPIAVYNVSAEYSMVKAAAQNGWIDEKGIVMEKMYAFK
RAGASIIITYHSKDIARWLKNKEIY
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atgtttaagagacacagaaggctaaggggcagtcaagtaatgagggatatggtgaaggat
ctttatctagatgtgaaagattttgtatatcctttatttatagaggaaggaaccggaata
agacaagaaatacagtctatgccgggacaatacagactatcgattgacatgctaaagcct
gaattggatgaaatatgggatctaggtattagaagtatattgatttttggtatacctctt
gaaaaagaccccatgggtaaagaggcttataatgatcttggaatagttcaggaagctgta
aggtttataaaaaaatcttatcctaaaatgctcgtgataacagacgtatgtatgtgtgag
tatacttcccacggtcactgtggtatattgagcgggcctcatgtactaaatgatgagact
ctttattacctttccaagatagctgtgtctcatgccaaggcaggtgctgatatggttgct
ccgtcagatatgatggacggaaggattttagctatgaggaaggcattagacaatgaaggg
tttataaacacccctataatgtcctatagtgtaaaatatgcatcatcattttacggtcct
ttccgtgatgctgcagactcatctccttcttttggcgacagaaagacctaccagatggac
tttagaagtacaaaagaagctttgagagaggcagaggcggatttagatgagggagctgac
attcttatagtgaagccggctttatcttatctagatgtggtaaaaagactttatagaaga
tacgatgttccaatagctgtctataatgtcagtgctgaatattccatggtaaaagctgct
gcccaaaacgggtggatagatgaaaagggaattgtcatggaaaaaatgtatgcctttaaa
agagcaggtgcttctataataataacctaccattcaaaggatatcgccagatggctcaag
aataaagagatatactaa

DBGET integrated database retrieval system