KEGG   Ilyobacter polytropus: Ilyop_2415Help
Entry
Ilyop_2415        CDS       T01337                                 

Definition
indole-3-glycerol phosphate synthase (EC:4.1.1.48)
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
ipo  Ilyobacter polytropus
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:ipo00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Ilyop_2415
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Ilyop_2415
Enzymes [BR:ipo01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     Ilyop_2415
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
pILYOP01:524149..524922
Genome map
AA seq 257 aa AA seqDB search
MILDEIVKSKKEYLKKLSLDKNKLAEIAENMDTPPSFYEAMKKSGLSIIGEVKKASPSKG
VIKEMFDHKAIAAVYDTCVDAISVLTEVEYFKGNPKYLKEVSEITKLPTLCKDFIIDEAQ
IYEARTLGASAVLLIVSILDDETLKNFIAIARELKMEPLVEAHSGEEVKRALKAKAKIIG
INNRDLKTFNVDLNNCIELSKNIPEDVLVIGESGISKREDVKKLKDGKISGVLIGEAFMR
SESINKLARELKEEFND
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgatattagatgaaattgtaaaatctaaaaaagaatatctaaagaaactatccctagat
aaaaataaacttgctgagatagcagaaaatatggatactccaccgagtttttatgaagct
atgaaaaaaagtgggctttctataataggtgaggtaaaaaaggcttctccgtctaagggt
gtaataaaggaaatgtttgatcacaaggctatagctgcagtatatgacacctgtgtagat
gcaatatctgttctcacagaggttgagtatttcaaaggaaatcctaaatatctgaaggaa
gtttcagagatcacaaaacttcctactttatgcaaagactttataatcgacgaagctcag
atatatgaggctagaactcttggagcctctgcagtacttctcattgtaagtattttagat
gatgaaaccttaaagaacttcattgctatagctagagaattgaaaatggagccccttgta
gaggcccacagcggtgaggaagtaaaaagagctctaaaggcaaaggctaaaataattgga
ataaacaacagagacttaaagacctttaatgtagatctaaacaactgcatagaactttct
aaaaatataccagaagacgtactggtaataggtgaaagtggtataagtaaaagagaagat
gtaaaaaaactcaaagatgggaaaataagcggtgtccttataggtgaagcctttatgaga
tccgaaagtataaataaactggcccgggaattaaaggaggaatttaatgactga

DBGET integrated database retrieval system