KEGG   Ilyobacter polytropus: Ilyop_2417Help
Entry
Ilyop_2417        CDS       T01337                                 

Definition
(GenBank) tryptophan synthase, beta chain (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
ipo  Ilyobacter polytropus
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:ipo00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Ilyop_2417
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Ilyop_2417
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Ilyop_2417
Enzymes [BR:ipo01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Ilyop_2417
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
pILYOP01:525510..526688
Genome map
AA seq 392 aa AA seqDB search
MDRKFGDFGGQYVPETLMKPLENLEKAYLKYKNDDEFNKELNYYLKDYVGRETPLYYAAS
LTEKVGGAKIYLKREDLNHTGAHKINNVMGQLLLAKRMGKTKVIAETGAGQHGVATATGA
ALLGMECEVFMGEEDIVRQEMNVFRMRLLGATVNSVTSGTGTLKDATNEAIRQWVARIDD
TFYVIGSVVGPHPYPTMVRDFQRIIGDETKKQIMEKEGRLPDAIVAAIGGGSNAMGIFYP
FVNDKEVRLIGVEAAGEGEATDKHALAMLKGSKGVIHGMKTYLLQDDMGNITPAHSISAG
LDYPGVGPEHAYLYDTKRAEYAPIDDKEALGGFKLLCEVEGIIPALESAHAVAHAVKVAK
EMSKDEILVINLSGRGDKDINTVLEVYQKGEL
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atggatagaaaatttggtgattttggagggcagtatgtgccggagactttgatgaagcct
cttgaaaatttggaaaaagcgtacttaaaatataaaaatgacgatgaattcaacaaagaa
ctgaattattatctaaaggattatgtaggaagagaaacacctctatactatgcagcttct
ctcacagagaaagtaggaggagcaaaaatatatctaaaaagagaagaccttaatcataca
ggtgcacacaagataaacaacgtaatgggtcaactccttcttgccaagagaatgggaaaa
acaaaggtcattgctgaaacaggagcaggacagcacggagtggccactgccacaggagcc
gcacttctaggaatggagtgtgaggtatttatgggagaggaagacatagtaagacaggag
atgaatgtcttcagaatgaggcttttaggagctactgtaaattctgtgacgtcagggaca
ggaactttgaaagatgctacaaatgaggctataagacagtgggttgccagaatcgatgat
acattttatgttataggttcagttgttggtcctcatccttatccgactatggtaagagat
ttccagaggataataggagacgagacaaagaaacagataatggaaaaagaaggtagactt
cctgacgctatagtagctgctatagggggaggatcaaatgctatgggtatattctatcct
tttgtcaacgacaaggaggttagactcatcggtgtagaggctgcaggggaaggggaagcc
acagataaacatgctcttgcgatgctaaagggaagtaagggagttattcatggtatgaag
acttatcttttacaagacgatatgggtaatataactcctgcacattctatctccgccggt
ttagattaccctggtgtaggacctgaacatgcttatctatacgatacaaaaagagcagaa
tatgctcctatagatgataaagaggccctaggaggtttcaagcttctctgtgaagtagaa
ggaattatccctgcattggagagtgcccatgcagtggctcatgcagtaaaagtagcgaaa
gagatgtcaaaagatgagattttagtaataaacttatctggacgtggagataaagatata
aatacagtattagaagtatatcaaaagggggagctataa

DBGET integrated database retrieval system