KEGG   Ilyobacter polytropus: Ilyop_2417Help
Entry
Ilyop_2417        CDS       T01337                                 

Definition
(GenBank) tryptophan synthase, beta chain
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
ipo  Ilyobacter polytropus
Pathway
ipo00260  Glycine, serine and threonine metabolism
ipo00400  Phenylalanine, tyrosine and tryptophan biosynthesis
ipo01100  Metabolic pathways
ipo01110  Biosynthesis of secondary metabolites
ipo01130  Biosynthesis of antibiotics
ipo01230  Biosynthesis of amino acids
Module
ipo_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:ipo00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Ilyop_2417
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Ilyop_2417
Enzymes [BR:ipo01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Ilyop_2417
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP ABC_membrane
Motif
Other DBs
NCBI-ProteinID: ADO84176
JGI: Ilyop_2417
UniProt: E3HDJ0
Position
pILYOP01:525510..526688
Genome map
AA seq 392 aa AA seqDB search
MDRKFGDFGGQYVPETLMKPLENLEKAYLKYKNDDEFNKELNYYLKDYVGRETPLYYAAS
LTEKVGGAKIYLKREDLNHTGAHKINNVMGQLLLAKRMGKTKVIAETGAGQHGVATATGA
ALLGMECEVFMGEEDIVRQEMNVFRMRLLGATVNSVTSGTGTLKDATNEAIRQWVARIDD
TFYVIGSVVGPHPYPTMVRDFQRIIGDETKKQIMEKEGRLPDAIVAAIGGGSNAMGIFYP
FVNDKEVRLIGVEAAGEGEATDKHALAMLKGSKGVIHGMKTYLLQDDMGNITPAHSISAG
LDYPGVGPEHAYLYDTKRAEYAPIDDKEALGGFKLLCEVEGIIPALESAHAVAHAVKVAK
EMSKDEILVINLSGRGDKDINTVLEVYQKGEL
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atggatagaaaatttggtgattttggagggcagtatgtgccggagactttgatgaagcct
cttgaaaatttggaaaaagcgtacttaaaatataaaaatgacgatgaattcaacaaagaa
ctgaattattatctaaaggattatgtaggaagagaaacacctctatactatgcagcttct
ctcacagagaaagtaggaggagcaaaaatatatctaaaaagagaagaccttaatcataca
ggtgcacacaagataaacaacgtaatgggtcaactccttcttgccaagagaatgggaaaa
acaaaggtcattgctgaaacaggagcaggacagcacggagtggccactgccacaggagcc
gcacttctaggaatggagtgtgaggtatttatgggagaggaagacatagtaagacaggag
atgaatgtcttcagaatgaggcttttaggagctactgtaaattctgtgacgtcagggaca
ggaactttgaaagatgctacaaatgaggctataagacagtgggttgccagaatcgatgat
acattttatgttataggttcagttgttggtcctcatccttatccgactatggtaagagat
ttccagaggataataggagacgagacaaagaaacagataatggaaaaagaaggtagactt
cctgacgctatagtagctgctatagggggaggatcaaatgctatgggtatattctatcct
tttgtcaacgacaaggaggttagactcatcggtgtagaggctgcaggggaaggggaagcc
acagataaacatgctcttgcgatgctaaagggaagtaagggagttattcatggtatgaag
acttatcttttacaagacgatatgggtaatataactcctgcacattctatctccgccggt
ttagattaccctggtgtaggacctgaacatgcttatctatacgatacaaaaagagcagaa
tatgctcctatagatgataaagaggccctaggaggtttcaagcttctctgtgaagtagaa
ggaattatccctgcattggagagtgcccatgcagtggctcatgcagtaaaagtagcgaaa
gagatgtcaaaagatgagattttagtaataaacttatctggacgtggagataaagatata
aatacagtattagaagtatatcaaaagggggagctataa

DBGET integrated database retrieval system