KEGG   Ilyobacter polytropus: Ilyop_2418Help
Entry
Ilyop_2418        CDS       T01337                                 

Definition
(GenBank) tryptophan synthase, alpha subunit (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
ipo  Ilyobacter polytropus
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:ipo00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Ilyop_2418
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Ilyop_2418
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Ilyop_2418
Enzymes [BR:ipo01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Ilyop_2418
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
pILYOP01:526688..527440
Genome map
AA seq 250 aa AA seqDB search
MGRIENALKKGEKNLIAYLTAGDPCIEKTPELVLGMESGGAALVEIGIPYSDPLADGPVI
QAASTRALSKDISIEKIFDAVEKIRKESQIPLVFLVYYNTIHNYGGEEFLKKCEETGVDG
LIIPDLPMEEQKELPKNAAVSIIPLVALNSGDRIENIVKDATGFVYCISSFGVTGTRDTI
SNKASEIVSEIKKYTDIPVALGFGISHNKMVEDVNRYADAAIVGSAIVKVIEKTKGSAKE
VEDFVASLLR
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgggtagaattgaaaatgcactgaaaaaaggagaaaaaaatcttatagcgtatctcact
gcaggtgatccatgtattgagaaaactcctgagcttgtactaggcatggagagtggaggt
gcagcacttgtagagataggtatcccatattcagatcctctagcagacgggcctgtgatt
caggctgcttctacaagggctctgtcaaaggatatttccattgagaagatttttgatgca
gtagaaaaaataagaaaagaaagtcagatacctttggtttttttagtctactataataca
atacataattatggtggggaagaatttcttaaaaaatgtgaggaaacaggtgtagacggc
cttattattcctgacctgccaatggaagagcaaaaagaacttccaaaaaatgcagcagta
agtataattccacttgtggctcttaattcaggtgatagaatagaaaatattgtaaaagat
gctacaggatttgtttattgtatttcctcatttggagttacaggtacgagagataccata
agtaataaagcttctgaaatagtttctgagattaaaaaatatacagatatacctgtggct
ttaggttttgggatatctcacaataaaatggttgaagatgtaaacagatatgccgatgca
gctatagtgggaagtgctattgtcaaggtaatcgaaaaaacaaaaggcagtgcaaaagaa
gttgaagattttgtagcttccctgctaagataa

DBGET integrated database retrieval system