KEGG   Ilyobacter polytropus: Ilyop_2418Help
Entry
Ilyop_2418        CDS       T01337                                 

Definition
tryptophan synthase subunit alpha (EC:4.2.1.20)
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
ipo  Ilyobacter polytropus
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:ipo00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Ilyop_2418
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Ilyop_2418
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Ilyop_2418
Enzymes [BR:ipo01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Ilyop_2418
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
pILYOP01:526688..527440
Genome map
AA seq 250 aa AA seqDB search
MGRIENALKKGEKNLIAYLTAGDPCIEKTPELVLGMESGGAALVEIGIPYSDPLADGPVI
QAASTRALSKDISIEKIFDAVEKIRKESQIPLVFLVYYNTIHNYGGEEFLKKCEETGVDG
LIIPDLPMEEQKELPKNAAVSIIPLVALNSGDRIENIVKDATGFVYCISSFGVTGTRDTI
SNKASEIVSEIKKYTDIPVALGFGISHNKMVEDVNRYADAAIVGSAIVKVIEKTKGSAKE
VEDFVASLLR
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgggtagaattgaaaatgcactgaaaaaaggagaaaaaaatcttatagcgtatctcact
gcaggtgatccatgtattgagaaaactcctgagcttgtactaggcatggagagtggaggt
gcagcacttgtagagataggtatcccatattcagatcctctagcagacgggcctgtgatt
caggctgcttctacaagggctctgtcaaaggatatttccattgagaagatttttgatgca
gtagaaaaaataagaaaagaaagtcagatacctttggtttttttagtctactataataca
atacataattatggtggggaagaatttcttaaaaaatgtgaggaaacaggtgtagacggc
cttattattcctgacctgccaatggaagagcaaaaagaacttccaaaaaatgcagcagta
agtataattccacttgtggctcttaattcaggtgatagaatagaaaatattgtaaaagat
gctacaggatttgtttattgtatttcctcatttggagttacaggtacgagagataccata
agtaataaagcttctgaaatagtttctgagattaaaaaatatacagatatacctgtggct
ttaggttttgggatatctcacaataaaatggttgaagatgtaaacagatatgccgatgca
gctatagtgggaagtgctattgtcaaggtaatcgaaaaaacaaaaggcagtgcaaaagaa
gttgaagattttgtagcttccctgctaagataa

DBGET integrated database retrieval system