KEGG   Ilyobacter polytropus: Ilyop_2701Help
Entry
Ilyop_2701        CDS       T01337                                 

Definition
histidinol dehydrogenase (EC:1.1.1.23)
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
ipo  Ilyobacter polytropus
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Histidine biosynthesis, PRPP => histidine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:ipo01230]
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:ipo00340]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
pILYOP01:843354..844637
Genome map
AA seq 427 aa AA seqDB search
MKILRSSEYDAIKAEILSRGDLDYKDINVTVEKIVKNVKENGDKAVLGYTAKFDGAELEN
MEVTKEEIDIAWERTPESLKNALTEAGNSIRTFHEKQKRNSFMDNSLKGKITGQLINPIE
KVGIYVPGGKSPYPSTVLMNAIPAKVAGVKELTMITPPGKSGEIMDNILVAAKIAGVDRI
FKIGGAQGVAALAYGTETVPKVYKITGPGNIYVALAKKQVYGMVDIDMIAGPSEILIIAD
DTANPRYIAADLLSQAEHDELASSILVTPSEKLAEAVSKEVDVQLAKLAKKEIAEKSLEN
YGRIIITKDLDEAIDMANDIATEHLELMVAEPFLYINSIKNAGAIFVGENSPEPLGDYYA
GPNHTLPTNGTSKFSSPLSVDDFIKKTSVIYYSKEALRGVKDTVLEISDSEGLTAHSNSI
RIRFEEE
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatactcagaagttcagagtatgatgccataaaggctgaaatactctcaaggggt
gatctcgactacaaagatatcaatgtcactgtagaaaagatcgtcaaaaatgtaaaggaa
aacggagacaaagcggtacttgggtatactgcaaagtttgacggggcagaattagaaaat
atggaagtcacaaaagaagagatagacatagcatgggaaagaactcctgaatctcttaaa
aacgccctcacagaagctggaaacagcataaggacattccatgaaaaacaaaagagaaat
tcatttatggataactcattaaagggaaaaatcaccggtcagcttataaaccctatagag
aaggtgggaatctatgtccctggaggaaagtctccatatccttcaactgtacttatgaat
gccatcccggcaaaggtggcaggagtaaaagaactcacaatgataactccccctggaaag
tcgggagagataatggataatatccttgtggctgcaaaaatagctggagttgacaggatc
ttcaaaatagggggagcccagggagttgctgctctagcttatggaactgaaacagtacca
aaggtatacaagatcacaggtccgggaaatatctacgttgcccttgctaaaaaacaggtc
tatggaatggtagatatcgacatgatagcaggacctagtgagatactaataatagcagac
gatacagctaatccaagatatatcgctgctgatctactctctcaagcagaacacgacgag
cttgcttcatctatacttgtgactcctagtgaaaaactggcagaggcagtatctaaagag
gtggacgtacagttagctaaacttgctaaaaaagagatagcagaaaaatctttagaaaat
tatggaagaatcataataacaaaggatctagatgaggctatcgatatggcaaacgacatc
gccacagaacatttagaactaatggttgctgagccttttttatacataaattccattaaa
aatgcaggggctatatttgtgggtgaaaacagtcctgaacctttaggagactactatgca
ggtccaaatcacacccttcctacaaacggtacttcaaaattttcatctcctttatcggtg
gatgatttcataaaaaagacctcggtaatttactattctaaggaagccttgagaggggta
aaagatactgtacttgaaatatcagacagtgagggactcacagctcacagcaattctatc
agaataagatttgaggaggagtaa

DBGET integrated database retrieval system