KEGG   Ictalurus punctatus (channel catfish): 108254751Help
Entry
108254751         CDS       T04658                                 

Gene name
abhd6
Definition
(RefSeq) abhydrolase domain containing 6
  KO
K13700  
abhydrolase domain-containing protein 6 [EC:3.1.1.23]
Organism
ipu  Ictalurus punctatus (channel catfish)
Brite
Enzymes [BR:ipu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     108254751 (abhd6)
Peptidases [BR:ipu01002]
 Serine Peptidases
  Family S33
   108254751 (abhd6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Position
21
AA seq 339 aa AA seqDB search
MDPDVVNMFIIAGGTLAIPILAFVASFLLWPAALFKIYYWYWRRRLGLQVDYAEHDGYRF
CYTHRGKPGSRPSILMLHGFSAHKDMWLAVVKFFPTNVHLVCVDMPGHAGTTRTSAVDYS
IEGQVKRIHQFVECVKLNKKPFHLVGTSMGGCVAGVYAARYPSDLSSLTLICPAGLKCPK
ESEFVRRLRDLENSTDVPRIPLIPSTPEEMEDMLKLCSFVRFKIPHQILQGLVKVRIPHN
NFYHEVFMELVGEKSRHCLHDNMHLISTPLQVIWGKQDQVLDVSGASLLADTLPGCQVDL
LDNCGHSVVMERPRKTAHLIMDFLTRQQNWGSGSNKKLS
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atggatccagacgttgtgaacatgttcatcatcgctggaggcacccttgcaatccccatt
ttagctttcgtggcttcttttctgctttggcctgcagcgcttttcaagatttattactgg
tattggaggaggagactggggctgcaggtggattatgcagagcatgacggatatcgcttc
tgttacacacaccgtgggaagcccggcagtcggccttctatacttatgcttcatggcttt
tctgctcacaaagacatgtggctggctgtggtgaagttctttccaaccaatgtgcatctg
gtgtgtgttgacatgcctggccatgcgggcactacgcgcactagtgcagtggactactcc
attgaaggccaggtcaaaaggatacatcagtttgtggaatgtgttaagctgaataagaag
ccttttcacctggtgggtacatccatgggtggttgtgtagctggggtttatgctgctcgc
tatccatctgatctgtccagtctcacactgatctgtcctgctggtctgaaatgccccaag
gagagtgaatttgtgagacgtttgagagacttggagaacagcacagatgtcccaagaatt
cctctcatcccctcgactccagaggaaatggaggatatgctgaagctttgctctttcgtg
cgctttaagatccctcatcagatccttcagggattggtcaaagtccgtattccacacaac
aacttctaccatgaggtgttcatggagttagtaggagaaaaatccagacactgcctgcat
gacaacatgcacctcatttcaacaccacttcaagtcatttgggggaagcaagatcaggtg
ctagatgtatctggtgcatctttgctggctgatactttgcccggatgtcaggtcgatctg
ttagacaactgtggccattctgtggtgatggagcgtcctcggaaaactgctcatctcatc
atggacttcctcacgcgccagcagaattggggaagcggtagcaacaaaaagctctcttga

DBGET integrated database retrieval system