KEGG   Ictalurus punctatus (channel catfish): 108265630Help
Entry
108265630         CDS       T04658                                 

Gene name
mgll
Definition
(RefSeq) monoglyceride lipase
  KO
K01054  
acylglycerol lipase [EC:3.1.1.23]
Organism
ipu  Ictalurus punctatus (channel catfish)
Pathway
Glycerolipid metabolism
Metabolic pathways
Module
Acylglycerol degradation
Brite
KEGG Orthology (KO) [BR:ipu00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    108265630 (mgll)
Enzymes [BR:ipu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     108265630 (mgll)
Peptidases [BR:ipu01002]
 Serine Peptidases
  Family S33
   108265630 (mgll)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Position
5
AA seq 300 aa AA seqDB search
MPEAEGSGRTPQGVPYSELPHIINADGLHLFCRYWEPEGPPKALVFVVHGAGEHCSAYAD
VAHTLTQHSLFVFAHDHVGHGQSEGERMNIKNFQIYIRDCLQHIDLIRTRYPNLPIFILG
HSMGGAISILTACEKPQDFAGVVLIAPMIQMNPESATPFKVFIAKVLNHMAPSLAIGSID
PKSVSRDPNQVQAYESDELVYHGGMRVSFGMQLMAASSRIETELPNISWPFLLLHGTADK
LCDIRGSHLMYNQAKSTDKKLKVYEGAYHALHHELPETAESVLQEVITWIIERLPAPSGP
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
atgccggaagcggagggatcgggccggactccgcagggtgtcccctacagcgagctcccg
cacatcatcaacgctgacggactgcacctgttctgccgctactgggaacctgaaggaccg
ccgaaggcactggtgtttgtggttcatggggctggagaacactgcagcgcgtatgccgac
gtcgctcacacactgacccaacactccctgtttgtgttcgcccatgaccatgtgggccat
gggcagagcgaaggggagaggatgaatattaaaaactttcagatctacatcagagactgt
cttcagcacatcgacctgataagaacgcgctaccccaacttgcccatcttcatccttggc
cactcgatgggtggtgccatctctattttgactgcatgtgagaagccgcaggatttcgcc
ggtgtggttctgatagcccccatgatccagatgaacccagaatctgccacacccttcaag
gttttcattgctaaagtcctgaaccatatggctcccagcctcgctatcggctccatcgat
cccaagtcggtctcacgggacccaaaccaggtgcaggcatatgaatcagatgagctggtt
tatcatggagggatgcgtgtatcgttcggaatgcagctgatggctgcttcaagccgcatc
gaaacagagcttcctaacatctcctggcctttcctgcttctgcatggaactgctgacaag
ctctgcgatatcagaggatcccatctcatgtacaaccaagctaagagcacagacaaaaaa
ttgaaggtgtatgaaggagcctaccatgccctgcaccatgagttgcctgagacggcggag
tctgtcctccaagaagtgatcacctggattattgagcgtcttcccgccccctctgggcct
taa

DBGET integrated database retrieval system