KEGG   Ixodes scapularis (black-legged tick): IscW_ISCW000133Help
Entry
IscW_ISCW000133   CDS       T01131                                 

Definition
ribokinase, putative (EC:2.7.1.15)
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
isc  Ixodes scapularis (black-legged tick)
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:isc00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    IscW_ISCW000133
Enzymes [BR:isc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     IscW_ISCW000133
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 324 aa AA seqDB search
MSTRTMNDSHNVESKDVEAIFLGACVVDLISYADRFPSPGETLIGNDFSMGHGGKGANSC
VMAVRMGLRCGMIAKVGSDRIGKDYLLYLRDIGLNTDHVEAVKGNASTATANIVVTKDGQ
NSIVYVHGAAALLTPDDVRRAEDLFKSAKILVAVFECPKATLLEALKLARKYKVATYVNA
APYDGGMVDEVYELTDILCVNETEAGQMVGFKVHSKETFQQAAEALLLKGCNTVIITLGE
QGACYCTRQLRTLTYVSIDKVRVEDTTGAGDAFNGAFAYHYARHTSAPLSETIKKACDIA
SLTVQSPGTQASYPELADIPARLL
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgtcgacacgcacaatgaacgactcccacaacgttgagtccaaagatgtcgaagctatt
tttcttggtgcctgtgtagttgacctaatcagttatgccgaccgctttccttcccccgga
gaaacgctaatcggaaacgatttcagcatgggccatggtggcaagggtgcaaactcctgc
gtcatggctgttcgaatgggtctacgatgtggcatgattgcgaaagttgggagtgataga
atcggcaaggactacctgctttacctccgcgacattggtcttaacactgatcatgttgaa
gccgtaaaaggaaatgcaagcaccgctacggctaatattgttgtcaccaaggacggacaa
aatagcatagtctacgtgcatggtgctgcggcccttctcaccccagacgatgtcaggaga
gctgaagacttgtttaagagtgccaagattcttgtggcggtctttgaatgtccgaaggca
acgcttttggaggcactcaagttggctcgcaagtacaaagtcgcgacgtacgtcaacgcc
gctccctacgacggcggcatggtggacgaagtctatgagttgaccgacatcctctgcgtc
aacgaaacggaggcgggccaaatggtgggcttcaaggtccactcaaaggaaacatttcag
caagcggccgaagcactcttgctcaagggctgcaacacggtgatcatcaccttgggtgaa
caaggagcttgctactgcacccgccagcttcgcacgctcacctatgtgagcatcgacaag
gtccgggtggaggataccacgggtgcaggcgacgcgttcaacggcgcgtttgcataccac
tacgcgaggcacacttcggcgcccctgagcgagacgatcaagaaagcgtgcgacattgcc
agcctcaccgtccagtcaccggggacgcaggccagctacccagagcttgccgacatcccg
gcaagacttctttga

DBGET integrated database retrieval system