KEGG   Ixodes scapularis (black-legged tick): IscW_ISCW000162Help
Entry
IscW_ISCW000162   CDS       T01131                                 

Definition
alkaline phosphatase, putative (EC:3.1.3.1)
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
isc  Ixodes scapularis (black-legged tick)
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:isc00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    IscW_ISCW000162
Enzymes [BR:isc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     IscW_ISCW000162
Exosome [BR:isc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   IscW_ISCW000162
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 420 aa AA seqDB search
MSRTWTGTAAPSPMAPVHVLLLLLTLASTLLGTVFGEGEFKIPDAAVEADKNHWYKLGAS
GIDGRLRHQVKVGRAKNVVLFLGDGMGIPTVTAARIYKGQRLSNRSGEESVLSWDIFPHL
SLARTYGLDVQTSDSANTATAYLCGVKANYETLGVDSRIKSGQCHSDTSTHLPSIMQWAQ
DSGLWTGIVTTTRVTHATPAASYSHSGHRNWEAAVPPDCDAKDIAYQLVHSSPGKGYKVI
LGGGRRVFLDKNMMDEEGKPGQRTDGKNLIKEWTDARKGEGNATYVWNKQGLLSVNPQKT
DYLLGLFDNSHVPYVIQRSEANTTKPTLPEMTKVAVDMLSRAPNGFVLLVEGIAGYSDVD
QLPFTVLTYGNGPGFSTDKTNFTNADVASIFCHPCRRFSYPSVLCNGSLFTWAKPMRASI
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcgcacgtggacgggcaccgccgcgccttcgccgatggccccggtgcacgttctg
ctgctgctgctcaccctggcttcgacgctgctcggaactgtattcggcgagggcgagttc
aagatccccgacgcagctgtcgaagccgacaagaaccactggtacaagctgggcgcctca
ggaatcgatggacgactcaggcaccaggtgaaggtcggacgagccaagaacgtggtgctc
ttcctgggagacggcatgggcattccgacggtgacggcggcgcgcatctacaagggccag
cgactgagcaaccgcagcggcgaggagagcgtcctatcctgggacatcttcccgcacctg
tccctggccaggacctacgggctggacgtgcagacgtcggactcggccaacacggccacg
gcctacctgtgcggggtcaaggccaactacgagacgctgggagtggactccaggattaaa
agcgggcagtgccacagcgacacgagcacccacctgccgagcatcatgcagtgggctcag
gactccggcctgtggacgggcatcgtgaccacgacccgggtcacgcacgccaccccggcc
gcgagttacagccactcgggacatcggaactgggaggccgcggtgcctcccgactgcgac
gccaaggacatcgcctaccagctagtgcactcgtcgccagggaagggatacaaggtgatt
ctgggaggcggtcgccgggtcttcctcgacaagaacatgatggacgaagaaggcaagccg
ggacagcgcacggacggcaaaaacctcatcaaggagtggacggacgccagaaaaggtgaa
gggaacgccacctacgtctggaacaagcagggacttctcagcgtgaacccgcagaagaca
gactacctgctcggtctcttcgacaacagccacgtgccgtacgtgattcagaggagcgag
gccaacaccactaagccgaccctaccagaaatgaccaaggttgcggtggacatgctgagc
agagctcccaacggatttgttcttctcgtcgaaggtattgctggctactcggacgtcgat
cagctgcctttcactgtcctcacctatggcaacggaccaggcttctctacggacaagact
aattttacgaacgccgatgtggcttccatattttgtcacccttgtcgaaggttctcctac
ccttcggtgctttgcaacggttctttgtttacgtgggccaagccaatgagagcatctata
taa

DBGET integrated database retrieval system