KEGG   Ixodes scapularis (black-legged tick): IscW_ISCW000229Help
Entry
IscW_ISCW000229   CDS       T01131                                 

Definition
copper type II, ascorbate-dependent monooxygenase, putative (EC:1.14.17.1)
Orthology
K00503  
dopamine beta-monooxygenase [EC:1.14.17.1]
Organism
isc  Ixodes scapularis (black-legged tick)
Pathway
Tyrosine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:isc00001]
 Metabolism
  Amino acid metabolism
   00350 Tyrosine metabolism
    IscW_ISCW000229
Enzymes [BR:isc01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.17  With reduced ascorbate as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.17.1  dopamine beta-monooxygenase
     IscW_ISCW000229
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 540 aa AA seqDB search
MAGQDPFLSSWLRALALLGASLLFAEAGGEQRRYFELVLDPQGRFTLYWTVDYDAQVLTA
ELKLNLARNDWFALGFSDRGEVGQADLCVLWADVREQPHLDDAWTDDAGYVTVDEQNDCV
LGSLKRRGSTVRFLLTRSFDTCDSHDYVIEDGTVHVVYATGTGPLRKLDGLRLTRAEHGF
QRAQLLKIMREPPPFPPDTKFVNFLNEKVPVPSDETTYWCTMHKLPSDFRYKRHIVRYEA
NVQKGNEALVHHMELFHCEVPPDQDLPAWNGPCHSPEKPEILERCKRVIAAWAMGAPPLA
YPEEAGLSAGGRDYSLFAMLEVHLNNPAHQSGFVDSSGITLYHTSELRPYDVGILEIGLE
YTDKMAIPPRQPAFDLTGYCISECTRVALPESGITLVAAQLHTHLTGRRVWVKHVRGGSE
LGEMARDDHFSTHFQEIRLLKDRLQLMPGDALVITCRYDTADRENITLGGFGITEEMCVS
YIHYFPKTDLEVCKSSIDSHSLESYFKYMNKMHACTAETAERRCYGHRCRSSAAIISKFA
NT seq 1623 nt NT seq  +upstreamnt  +downstreamnt
atggctggacaagatccgtttctgtcctcctggttgcgagcgctcgcactcctcggagcc
tcgctgctctttgccgaggccggaggagagcagcggcgctacttcgagctcgtgctggat
cctcaggggcggttcacgctgtactggacggtggactacgacgcccaagtgttgaccgcc
gagctcaaactcaacctggcgcgcaacgactggttcgccctaggcttttcggaccgggga
gaggtgggccaggcggacctgtgcgtcctctgggcagacgtcagggaacagccgcatctc
gacgacgcctggaccgacgacgccggctacgtgacggtggacgagcagaacgactgcgtg
ctgggcagcctcaagcgacgagggtccacggtgcggttcctgctcacgcgcagctttgac
acctgcgactcgcacgactacgtcatcgaggacggcacagtccacgtggtgtacgccaca
ggcacgggcccgctgcgcaagctggacggcttgcggctgactcgtgccgagcacggcttc
cagagggcgcagctgctgaagatcatgagggagccgcctccctttcccccggacaccaag
ttcgtcaacttcctcaatgagaaggtcccggtgcccagcgacgaaacgacctactggtgc
acgatgcataagctgccctcagacttccgctacaagaggcacattgttcggtacgaggcc
aacgtccagaagggtaacgaagccctagtgcaccacatggagttgttccactgcgaggtg
ccgccggaccaggacctgccggcctggaacggaccctgccacagtcccgagaaaccggag
atcctcgagaggtgcaagagggtcatcgcagcttgggccatgggggctccgcctctggcg
tacccagaagaagccggcctgtcggcgggaggcagggattactccctattcgccatgctg
gaggtgcacctgaacaacccggcgcaccagagtggcttcgtggatagctccggcatcacg
ctgtatcacacgagtgagctgagaccctacgacgtgggcatcctcgagatcggcctcgag
tacaccgacaagatggccatccctccgcgccagccggcgttcgacctcacgggctactgc
atctccgaatgcaccagagtggcactgcccgagtccggcatcaccctggtggcggctcag
ctgcacacccacttgaccggtcgacgtgtctgggtcaagcacgtccgcggaggaagcgag
ctcggtgaaatggcgcgcgacgaccacttcagcacccacttccaggagatacgcctcctc
aaggacaggctacagctcatgcccggtgacgccttggtgataacgtgccgctacgacacc
gcggatcgtgaaaacataacactgggcggctttggcatcacggaggagatgtgcgtttcc
tacatccactacttccccaagacagacctggaggtgtgcaagagctccatcgactcgcac
tccttggaaagctacttcaagtacatgaacaagatgcatgcatgcacggccgagacggcc
gagaggcgctgctacggacaccggtgccgtagttcggcagccataatctcgaagtttgcg
taa

DBGET integrated database retrieval system