KEGG   Ixodes scapularis (black-legged tick): IscW_ISCW001453Help
Entry
IscW_ISCW001453   CDS       T01131                                 

Definition
(RefSeq) hypothetical protein
  KO
K09585  thioredoxin domain-containing protein 10 [EC:5.3.4.1]
Organism
isc  Ixodes scapularis (black-legged tick)
Brite
Enzymes [BR:isc01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     IscW_ISCW001453
Chaperones and folding catalysts [BR:isc03110]
 Protein folding catalysts
  Protein disulfide isomerase
   IscW_ISCW001453
Membrane trafficking [BR:isc04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   PDI family proteins
    IscW_ISCW001453
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Thioredoxin_6 YhdK
Motif
Other DBs
NCBI-GeneID: 8025402
NCBI-ProteinID: XP_002409025
VectorBase: ISCW001453
UniProt: B7P6M6
AA seq 217 aa AA seqDB search
MAEEFQPVNYFFSAPPKCIGQVAGMTTPASPAVYVFKDGTSFMYDEGEAAERNTTFLDWM
SKERFPTFQKITYGNFYQVLKTGKKIVTAVLEENQIGKISMRMQEFKDTLEAIALNTREL
YHEHFVFGWVGAPDIVNSVAMMNLPVPSLLVIKPDTYQYFLPEGDVREQPPSPQAVLELL
NTILDGSAVVSGPFMHLCTILPFFVVPTLLFNEDIDV
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atggccgaagagttccagcccgtcaattacttcttctccgcaccacccaagtgcattggc
caggttgcgggtatgaccacgccagcatctccagctgtgtatgtgttcaaggacggcaca
agtttcatgtatgatgaaggcgaggctgcggagagaaacaccactttcttggactggatg
agcaaggaaaggttccccacattccagaagataacttatggaaacttctaccaagtactg
aagactgggaagaagattgtcaccgctgtcctggaggaaaaccagattggaaagatatcg
atgcggatgcaagagttcaaagacacgcttgaggccattgctctcaacacaagagaactg
taccacgagcactttgtttttggctgggtgggagctcccgacatcgtcaactcggtggcc
atgatgaacctgcctgtcccgagcctgctggtgatcaagcctgacacctaccagtacttc
ctgcccgagggagacgtccgggagcagccgccttccccgcaggcggtgctcgaattgctc
aacaccatcctggacggctccgctgtggtaagtgggccattcatgcacctttgcactatc
ctgcctttctttgttgtacccactttgctgtttaacgaggatattgatgtctag

DBGET integrated database retrieval system