KEGG   Ixodes scapularis (black-legged tick): IscW_ISCW001645Help
Entry
IscW_ISCW001645   CDS       T01131                                 

Definition
(RefSeq) lysozyme, putative
  KO
K13915  lysozyme C [EC:3.2.1.17]
Organism
isc  Ixodes scapularis (black-legged tick)
Brite
Enzymes [BR:isc01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     IscW_ISCW001645
Exosome [BR:isc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   IscW_ISCW001645
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Lys SLT Transglycosylas Destabilase
Motif
Other DBs
NCBI-GeneID: 8023211
NCBI-ProteinID: XP_002399439
VectorBase: ISCW001645
UniProt: B7P0W4
AA seq 139 aa AA seqDB search
MRVRLALLVFALLEASAAKKFTRCELASALVRGGVPKPQIPDWICLAQAESSLNSRATNR
NKNGSTDFGIFQINNGYWCSPGRHNLCKVSCSALQSDNIGPSIKCARQIYRSSGFKAWYG
WKNKCRGKNLSSYVKGCRY
NT seq 420 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgttcgcctggcgctgctggtgtttgcgcttctcgaagcgtccgctgccaagaag
ttcaccaggtgcgagctggcttctgcgctggtgaggggcggcgttcccaaaccgcagatt
cctgactggatctgcctggctcaagctgaaagtagcttgaactcgagggccacaaacagg
aacaaaaatggaagcaccgacttcggcatttttcagataaacaacggctattggtgcagt
cctggaagacacaacctgtgcaaggtatcctgctcggccttgcagtcggacaacataggg
ccgtccatcaaatgtgccaggcagatctataggagttctggcttcaaagcatggtacgga
tggaaaaacaagtgccgaggaaagaacttgagctcgtatgtcaagggatgtaggtactga

DBGET integrated database retrieval system