KEGG   Ixodes scapularis (black-legged tick): IscW_ISCW002080Help
Entry
IscW_ISCW002080   CDS       T01131                                 

Definition
protein disulfide isomerase 1, putative (EC:1.8.4.9 5.3.4.1)
Orthology
K09584  
protein disulfide-isomerase A6 [EC:5.3.4.1]
Organism
isc  Ixodes scapularis (black-legged tick)
Pathway
Protein processing in endoplasmic reticulum
Class
Genetic Information Processing; Folding, sorting and degradation; Protein processing in endoplasmic reticulum [PATH:isc04141]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 435 aa AA seqDB search
MALGFITVLATFAATATALYGPHTEVVDLSSANFRNRVVDSDEVWIVEFFAPWCGHCQSF
APEYIKAAAALKGVVKVGAVDADKDKSLAGQYGVRGFPTVKIFGVNKNSPTDFNGARTAE
GVASAGLQELKKVVDQRLGKKTSSGGSKGKSDVVELDESNFEELVLDSEDLWLVEFFAPW
CGHCKNLAPHWEKAATELKGKVKLGAVDATVHQGLASKYGIKGFPTIKFFPGGKKDSSSA
EEYNGGRTADDIVHWALEKAADAAPPPELHQVTNTKVLQDACENNQLCVVSVLPHIYDCQ
SECRNGYLDVLRRLGDKFRRNRWGWVWAEALAQPKLEEALEIGGFGYPALAVLNSRKMKY
SLLRGSYSYEGINEFLRELSFGRGSSVSVKGAKLPDVVDTEAWDGKDAKMEEPEDIDLSD
VELEPEETDKKRVEL
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
atggcactgggatttattacagtgctggccacttttgccgccacggccacggcactgtac
ggccctcacactgaagtcgtagacctttcctccgccaactttagaaacagggttgtggac
agcgacgaagtgtggatcgtcgagttctttgctccctggtgtggacactgtcagtcattt
gctccagaatacatcaaagcagctgctgcactaaagggagtcgtgaaggttggtgccgtg
gacgcagacaaggacaagtccttggcaggacagtacggcgttcgaggcttcccgacggtc
aagatcttcggtgtcaacaagaacagtccgacagacttcaacggtgcgcgcactgccgaa
ggcgtggccagtgccgggctccaggagctcaagaaggtcgtcgaccagcgtcttggcaag
aaaactagcagcggaggcagcaagggcaagagcgacgtcgtcgaactggatgagagcaac
tttgaggagcttgtgctggacagcgaggacctctggctggtggagttctttgcaccctgg
tgcggccactgcaagaacctcgccccgcattgggagaaagcggccaccgagctcaagggc
aaggttaagctgggcgccgtcgatgccaccgtccatcaggggctcgcctccaagtacggc
atcaagggcttccccaccatcaagttcttcccgggcggaaagaaagactcgtcctcggct
gaagagtacaatggcggccgcacggctgatgacattgtccactgggcgctcgagaaggcc
gcggacgccgccccgccacctgaactccaccaggtgacaaacaccaaggtgctccaggat
gcgtgcgagaacaatcagctgtgcgtggtgagcgtgctgccgcacatctacgactgtcag
tcggagtgccgcaacggctacctggacgtgctgcggcggctaggggacaagttccgacgg
aaccgctggggctgggtctgggccgaggccttggcacagcccaagctggaggaggccctg
gagatcggcgggttcggctacccggcgctggcggtgctgaacagccggaagatgaagtac
tcgctgctgaggggctcgtacagctacgagggcatcaacgagttcctgcgggagctctcg
ttcgggaggggctcgagtgtgtctgtgaagggggccaagcttccagacgtggtggatacg
gaggcgtgggacggcaaggatgccaagatggaggaaccggaagacatcgacctgagcgat
gtggagctggagccggaggagaccgacaagaagcgggtggagctctag

DBGET integrated database retrieval system