KEGG   Ixodes scapularis (black-legged tick): IscW_ISCW002395Help
Entry
IscW_ISCW002395   CDS       T01131                                 

Definition
nucleotidase 4F8, putative (EC:3.1.3.7)
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
isc  Ixodes scapularis (black-legged tick)
Pathway
Sulfur metabolism
Metabolic pathways
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:isc00920]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 186 aa AA seqDB search
MEGFLDHVTILVGIAVDGKAVGGVIHQPYYNYQVEKDVYKQGRTMWGIVGVGAFGISRIA
PPENKRIITTTRSHSSPTINSCIEAMNPDEVLRVGGAGHKVLLLIEGKAHAYVFPSKGCK
KWDTCAPEAILHATGGLLTDVHGNRLEYHKDVEHVNAGGVLATCLKEQHEWFKNHIPEDV
RKTLPL
NT seq 561 nt NT seq  +upstreamnt  +downstreamnt
atggaaggtttcctggaccacgtgacgatcctggtggggattgcggttgacggtaaggca
gtgggtggagtgatccaccagccgtactacaactaccaggtggagaaggacgtctacaag
cagggacgtaccatgtggggcattgtcggcgtcggtgcctttgggatctcgcgcattgcg
cccccggagaacaagaggatcatcactacgacgcgctcccactccagccccaccatcaac
agctgcattgaagccatgaatccggatgaggtgctgcgagttggaggtgccgggcacaag
gtgctgctgttgattgagggcaaggctcatgcttacgtgtttcccagcaaagggtgcaag
aaatgggacacttgtgctcccgaagcgattcttcatgccactggcggccttcttacagat
gttcacgggaacagattggagtaccacaaggacgtggaacacgtcaacgccggcggcgtt
cttgccacctgcctgaaggaacaacacgaatggttcaagaaccacattcctgaagatgtc
cgcaagacacttcctctatga

DBGET integrated database retrieval system