KEGG   Ixodes scapularis (black-legged tick): IscW_ISCW002395Help
Entry
IscW_ISCW002395   CDS       T01131                                 

Definition
nucleotidase 4F8, putative (EC:3.1.3.7)
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
isc  Ixodes scapularis (black-legged tick)
Pathway
Sulfur metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:isc00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    IscW_ISCW002395
Enzymes [BR:isc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     IscW_ISCW002395
Transfer RNA biogenesis [BR:isc03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    IscW_ISCW002395
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 186 aa AA seqDB search
MEGFLDHVTILVGIAVDGKAVGGVIHQPYYNYQVEKDVYKQGRTMWGIVGVGAFGISRIA
PPENKRIITTTRSHSSPTINSCIEAMNPDEVLRVGGAGHKVLLLIEGKAHAYVFPSKGCK
KWDTCAPEAILHATGGLLTDVHGNRLEYHKDVEHVNAGGVLATCLKEQHEWFKNHIPEDV
RKTLPL
NT seq 561 nt NT seq  +upstreamnt  +downstreamnt
atggaaggtttcctggaccacgtgacgatcctggtggggattgcggttgacggtaaggca
gtgggtggagtgatccaccagccgtactacaactaccaggtggagaaggacgtctacaag
cagggacgtaccatgtggggcattgtcggcgtcggtgcctttgggatctcgcgcattgcg
cccccggagaacaagaggatcatcactacgacgcgctcccactccagccccaccatcaac
agctgcattgaagccatgaatccggatgaggtgctgcgagttggaggtgccgggcacaag
gtgctgctgttgattgagggcaaggctcatgcttacgtgtttcccagcaaagggtgcaag
aaatgggacacttgtgctcccgaagcgattcttcatgccactggcggccttcttacagat
gttcacgggaacagattggagtaccacaaggacgtggaacacgtcaacgccggcggcgtt
cttgccacctgcctgaaggaacaacacgaatggttcaagaaccacattcctgaagatgtc
cgcaagacacttcctctatga

DBGET integrated database retrieval system