KEGG   Ixodes scapularis (black-legged tick): IscW_ISCW002690Help
Entry
IscW_ISCW002690   CDS       T01131                                 

Definition
serine/threonine protein kinase, putative (EC:2.7.11.17)
Orthology
K11481  
aurora kinase A [EC:2.7.11.1]
Organism
isc  Ixodes scapularis (black-legged tick)
Brite
Enzymes [BR:isc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     IscW_ISCW002690
Protein kinases [BR:isc01001]
 Serine/threonine protein kinases: Other group
  Aur family [OT]
   IscW_ISCW002690
Protein phosphatases and associated proteins [BR:isc01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     IscW_ISCW002690
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 278 aa AA seqDB search
MSACRFTTEWTLQDFEVGKPLGKGKFGNVYLAREKNTKFIIALKVMFKSQLQKNNVEHQL
RREIEIQSHLSHPHVLKLYGWFHDATRIYLILEYAPNGELYKQLTKAKRFDDKRAATYIY
QMCVALKYCHANKVIHRDIKPENLLLGYNGELKIADFGWSVHAPSSRRVTMCGTLDYLPP
EMVENSVYDERVDLWALGVLTYEFLVGNPPFESKSTQATYGRIRAVDLHFPDHVCPPARD
LIGKLLKKVPKERASLDEVLAHPWVVDNADTTVEASTL
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
atgtctgcttgcaggttcacaacggaatggacactgcaggattttgaagtaggcaagcca
ctgggcaaggggaagttcggaaatgtttacctggcacgcgagaaaaacaccaagttcatc
atcgccctcaaggtgatgtttaaatctcagcttcaaaaaaataatgttgagcatcagctt
cgccgggaaattgaaatccagtcgcatctcagccaccctcacgtcctgaaactgtacggg
tggttccacgacgccacccggatctacctgatcctggagtatgcacccaacggcgagctc
tacaagcagctcacaaaggccaagaggttcgacgacaagagggccgccacctacatctac
cagatgtgtgtggccctcaagtattgtcacgccaacaaggtgatccaccgggacatcaag
cccgagaacctgcttctcggctacaacggggagctcaagattgcggacttcggctggtcc
gtgcacgcgccctcatccaggcgggtgaccatgtgcggcaccctggactacctgccgccc
gagatggtggagaacagcgtgtacgacgagcgggtggacctgtgggccctgggcgtgctc
acctacgagttcctggtgggcaacccgcccttcgagtccaagtctacccaggccacctac
ggtcgcatccgtgccgtggatcttcacttcccggatcacgtctgcccgccggctagggac
ctcatcggcaagctcctgaagaaagtcccgaaggaacgagcatcgttggacgaagtgctg
gcacacccgtgggtcgtggacaacgccgacacgacggtcgaagcgtcaactctttga

DBGET integrated database retrieval system