KEGG   Ixodes scapularis (black-legged tick): IscW_ISCW002749Help
Entry
IscW_ISCW002749   CDS       T01131                                 

Definition
Cdk activating kinase, putative
Orthology
K06634  
cyclin H
Organism
isc  Ixodes scapularis (black-legged tick)
Pathway
Basal transcription factors
Nucleotide excision repair
Module
Holo-TFIIH complex
Brite
KEGG Orthology (KO) [BR:isc00001]
 Genetic Information Processing
  Transcription
   03022 Basal transcription factors
    IscW_ISCW002749
  Replication and repair
   03420 Nucleotide excision repair
    IscW_ISCW002749
Transcription machinery [BR:isc03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     IscW_ISCW002749
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 212 aa AA seqDB search
MTAACVTGTSFHYFKRFYLNNSVMDYHPKHMLVTCVYLACKVEEFNVSIAQFVNNVRGDR
EKATDIILNNELLLMQQLEYHLTIHNPYRPLEGLLIDIKTRCPQFPDPEKLRSLMDDFLE
RTLFTDAVLLMAPSQANQRTSATLLAGDQWRYVTDILFAGCSHDKLHHIKDAVKKLHLMV
KAIQVPPKDRVRAAEQKLEKCRNQENNPDSQM
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
atgacagcagcgtgcgttactggcacgtcgttccattacttcaaacgcttctacctcaac
aactccgtcatggactaccatccgaagcacatgttggtgacgtgcgtctacctggcgtgt
aaggtggaggagtttaacgtgtccatcgcccagttcgtgaacaatgtccggggggaccgg
gagaaggcgactgacatcatcctcaacaacgagctcctgcttatgcagcagctcgagtac
cacctgaccatccacaacccgtaccgacccctcgaagggctgctcattgacatcaagacg
aggtgtcctcagtttccagaccccgagaagctgagatctcttatggatgactttctggag
aggacactgttcaccgatgccgtgctgctcatggccccttctcaggcgaaccaacgaaca
tcggcaacgttgctggcgggggaccagtggcgatacgtcacggacatcctctttgcaggc
tgttcgcacgacaagttgcaccacatcaaggacgcagtcaagaagctgcacctgatggtg
aaggccattcaggttcccccaaaggacagggtgcgggcagcagagcagaaacttgaaaaa
tgcaggaaccaggagaataaccctgacagccaaatgtga

DBGET integrated database retrieval system