KEGG   Ixodes scapularis (black-legged tick): IscW_ISCW003434Help
Entry
IscW_ISCW003434   CDS       T01131                                 

Definition
1,4-alpha-glucan branching enzyme, putative (EC:2.4.1.18)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
isc  Ixodes scapularis (black-legged tick)
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:isc00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    IscW_ISCW003434
Enzymes [BR:isc01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     IscW_ISCW003434
Exosome [BR:isc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   IscW_ISCW003434
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 603 aa AA seqDB search
MEVPEIGNLLDLDPYLKNYEQEIRRRYKCFSDRLTEIENVEGLLRFCKSYEEYGIHCLPD
NSVRIREWAPGAEALFLRGDFNGWERLTHPFKKLPFGKWELTLPPKPDGSCPIDHLSRIK
IVVLDRTTGQLADRNSPWATYVVRGKDAPQYEQRLWNPPPEERHQWKHPKVAAPQSLRIY
ECHVGIASEDYWVANYSYFTSHVLPRIKAQGYNAIQIMAIMEHAYYASFGYQVTSFFAAS
SRYGTPEELKALVDAAHGMGLYVLLDIVHSHASKNVLDGLNRFDGTDACFFHNGGRGHHP
LWDSRLFDYTKLEVLRFLLSNVNWYLTEYRFDGLRFDGVTSMLYHSHGMGHGFSGDYNEY
FGLNVDTESLVYLMLANHVVHKLHPTAITIAEALVGDKTLAFWLMDKEMYTHMSTLTPLT
PVVDRGLAMHKLIRLLTHALGGEAWLNFIGNEFGHPEWLDFPRAGNDESYHHARRQWHLV
EDDLLRYKFLNRFDSALNHLEEQHHWLPSPPHEDDKVIAFERAGLLFVIGLHPCKSFTDY
QLGIDVPGEYRIVLDTDAEEFGGHRRIDHSVRCFTFDQPYAGRRHSIKVRPFDSWELLGG
GSV
NT seq 1812 nt NT seq  +upstreamnt  +downstreamnt
atggaggtccccgaaatcggcaacttgctggacctcgacccgtatctgaaaaactacgag
caggagatcaggcgacggtacaagtgcttctccgatcgcctgaccgaaatcgagaacgtc
gaagggctgctcaggttctgcaagagctatgaagaatacggcatccactgcctgccggac
aacagcgttcgcatcagggagtgggcccccggcgccgaggcactcttcctccgcggagac
ttcaacggctgggagcggctgacacatccgttcaagaagctgcccttcggcaagtgggag
ctgacgctgccgccaaaaccggatggctcctgtcccattgaccacctgtccaggatcaag
atcgtggtcctggacaggacgacagggcagctggcggaccgcaacagcccctgggcaact
tacgtggtgcgcggcaaagacgccccgcagtacgagcagcggctctggaatcccccacca
gaggagcggcaccagtggaagcatcccaaggttgccgctccccagagcctgcgcatctac
gagtgccacgtgggcatagcctcggaggattactgggtggccaactacagttacttcacc
tcccacgtcctgccgcgcatcaaggcacagggttacaatgccatccagataatggccatc
atggagcacgcttactatgccagctttgggtaccaggtgacaagcttctttgccgcttcc
agccgctacggcacccccgaagagctgaaggccctggtggacgctgcccacggtatgggc
ctgtacgtgctgctggacattgtgcacagccatgcctccaagaacgtgctggacggcctg
aaccgctttgatggcaccgacgcctgcttcttccacaacggcggccggggtcaccacccg
ctctgggacagccgcctcttcgactacacaaagctggaggtgctgcgcttcctgctgtcc
aacgtgaactggtacctaacggaataccgcttcgacggcctgcgctttgacggggtcacc
tcgatgctgtaccactcgcacggcatgggccacgggttcagcggggactacaacgagtac
ttcggcctcaacgtggacacagagtctctcgtctacctcatgctcgccaaccacgtggtc
cacaagctgcacccgaccgcaatcaccatcgcagaggctctggtgggggacaagacactg
gccttctggctcatggacaaggagatgtacacgcacatgtcgaccctgacgcccctgaca
cctgtggtggaccggggcctggccatgcacaagctcatccgcctgctcacccacgccctc
gggggcgaggcctggctcaacttcatcggcaacgagtttgggcaccccgagtggctcgac
ttcccgcgggcgggcaatgacgagagctaccaccacgcccgtcgccagtggcacctggtg
gaggacgacctgctgcgctacaagttcctcaaccgcttcgacagcgccctcaaccacctc
gaagagcagcaccactggctgccctctccgccccacgaggacgacaaggtgatcgccttc
gagagggcggggctgctgttcgtcatcggcctgcacccgtgcaagagcttcaccgactac
cagctgggcatcgacgtgccaggagaatacaggatagtcctggacacggacgctgaggaa
ttcggcggccacaggcgcatcgaccacagcgtcaggtgcttcaccttcgaccagccctac
gcgggacgcaggcattctatcaaggtgcgacctttcgactcatgggaacttttaggcgga
ggctcagtgtga

DBGET integrated database retrieval system