KEGG   Ixodes scapularis (black-legged tick): IscW_ISCW003529Help
Entry
IscW_ISCW003529   CDS       T01131                                 

Definition
protein kinase, putative (EC:2.7.11.24)
Orthology
K04468  
nemo like kinase [EC:2.7.11.24]
Organism
isc  Ixodes scapularis (black-legged tick)
Pathway
FoxO signaling pathway
Wnt signaling pathway
Class
Environmental Information Processing; Signal transduction; Wnt signaling pathway [PATH:isc04310]
Environmental Information Processing; Signal transduction; FoxO signaling pathway [PATH:isc04068]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 375 aa AA seqDB search
SVTDPRDGKRVALKKMPNVFQNLVSSKRVYREIKMLCFFKHENVLSALDILQPPHLDFFQ
EIYVTTELMQSDLHKIIVSPQPLTSDHLKVFLYQILRGLKYLHSSRILHRDIKPGNLLVN
SNCILKICDFGLARLEERDEQRHMTQEVVTQYYRAPELLMGARHYGPAVDIWSVGCIFAE
LLGRRILFQAQTPIQQLELITELLGTPSLEDMRHGCEGARAHLLRRPSKLPSLAALYTLS
PQATHEAVHLLCQMLVFNPDKRITCADALSHPYLEEGRLRYHSCMCRCCQSTPAGRHYVA
DFEPVAAHPFDDSFESDLVSVHQVKEKLHKFILERCAISSRVPLCINPLSTAFKSFASST
VAHPSELPPSPHQWE
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
tcggtcacagacccccgagatggcaaacgggtggctctcaaaaagatgcccaacgtgttc
cagaacctggtttccagcaaaagggtctatcgtgagatcaagatgctgtgtttcttcaag
cacgaaaacgttttgtcagcactggatatcctacagcctccacacctagacttcttccaa
gaaatatatgtcacaacggaactaatgcaaagtgatctgcacaaaatcatagtgtcgcca
cagcccctcacttcggaccacttgaaggtttttctctatcaaatattgagaggcttgaag
tatctgcactcctcgaggatactccaccgagacatcaaaccggggaatctgttggtgaac
agcaattgcatcttaaagatctgcgacttcggcctggcacgcctggaggagcgggacgag
cagcggcacatgacgcaggaggtggtgacgcagtactaccgggcccccgaattgctcatg
ggggcacgccactacgggccggccgtggacatctggtccgtgggctgcatctttgcagag
ctgctgggcaggcgcatcctcttccaggcacagacccccatccagcagctggagctgatc
acggagctgctgggcacgcccagcctggaggacatgcgccacggctgcgagggcgcccgt
gcccacctgctgcggcgcccctcgaagctgccctccctggccgccctctacaccctctct
ccgcaggccacccacgaggccgtccacctgctctgccagatgctcgtctttaacccggac
aagcgcatcacgtgcgcagatgccctatcgcacccgtacctggaggaagggcggctgcgc
taccactcgtgcatgtgccgctgctgccagagcaccccagccggacgccactatgtggcc
gactttgagcccgttgcggcgcaccccttcgacgactccttcgagtcggacctcgtctct
gttcaccaagtcaaagagaaactacacaagttcatcctagaaaggtgtgcaatttcgagc
cgggtcccactgtgcatcaacccactctcgacagctttcaagagcttcgcaagctcgacg
gtggcccacccctcggagctgccgccttccccacaccagtgggagtga

DBGET integrated database retrieval system