KEGG   Ixodes scapularis (black-legged tick): IscW_ISCW003887Help
Entry
IscW_ISCW003887   CDS       T01131                                 

Definition
protein-glutamine gamma-glutamyltransferase, putative (EC:2.3.2.13)
Orthology
K05619  
transglutaminase 1 [EC:2.3.2.13]
Organism
isc  Ixodes scapularis (black-legged tick)
Brite
Enzymes [BR:isc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     IscW_ISCW003887
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 358 aa AA seqDB search
CRSLGIPARAVTNYYSAHDTHSSLTVDLFIDEKGQDVDKMNTDSIWNFHVWTEVWMARPD
LEPGDYMGWQVIDATPQEKSDGLFRLGPVSVKAVKRGEILKPYDCPFVFAEVNADQISWR
YLGPKQPLKIIKKNTDKIGQRISTKAVGCWDREDLTDSYKQPERTKEERDVVLKALRESN
HAYSRYYLNVDLEDVSFDFDRLEDVMIGSDFVIKLKASNKNAAKAYPAQVIIRVEVMSYT
GANKMPIKVNSYNVMIPPGETQLVELPITYGDYARHLHSQCLFNIYTIASIREVKYDYIA
QHDFMVRLPRVKINVRHLLQFVGLKTRYGVKDLNFRGFACIVPRHDKQVGQGLLDKTG
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
tgccgaagtctgggcattccagccagggccgtgaccaactactactctgcccacgacacg
catagcagcttgacggtggacctgttcatcgacgagaaaggccaggatgtcgacaaaatg
aacaccgactccatctggaacttccacgtctggaccgaggtctggatggcacgcccggac
ctggagcccggagactacatgggatggcaagtcatcgatgcgacgccacaagaaaagtcc
gatggactcttccgtctcggtcccgtcagtgtgaaggcggtcaagagaggagagattctc
aaaccctacgattgcccgttcgtctttgctgaggtgaatgcagaccagatctcctggcgc
tacttgggccccaagcaacccctcaagataattaaaaagaacacggacaagatagggcag
cgcatcagtaccaaggcagtcggctgctgggacagggaagacttgaccgacagctacaaa
caaccagagagaaccaaggaagaacgtgatgtggtcctgaaggctctgcgggaaagtaac
cacgcctactctcggtactacctaaacgtggacctggaggacgtctccttcgactttgac
cgcctggaagacgtcatgatcggatcggacttcgttatcaaactaaaggcgtccaacaag
aatgctgcgaaggcttatccagcccaggttatcatccgggttgaagtaatgagctacaca
ggagctaacaagatgcccatcaaggtcaacagttacaacgtcatgatcccgcctggcgaa
acgcaactggtggagctgcccatcacttacggggattacgcgaggcacctgcattcccaa
tgcctgttcaacatctataccatcgctagcattcgggaggtcaagtatgactacattgct
cagcacgacttcatggttcggttgcctcgggtcaagataaacgtaagacatctcctgcaa
ttcgtgggtctcaagacacggtacggagtgaaggaccttaattttcgtggctttgcttgc
attgtccctcgccatgacaaacaagtaggtcaggggctattggacaagaccgggtaa

DBGET integrated database retrieval system