KEGG   Ixodes scapularis (black-legged tick): IscW_ISCW004208Help
Entry
IscW_ISCW004208   CDS       T01131                                 

Definition
(RefSeq) beta-N-acetylhexosaminidase, putative
  KO
K12373  hexosaminidase [EC:3.2.1.52]
Organism
isc  Ixodes scapularis (black-legged tick)
Pathway
isc00511  Other glycan degradation
isc00520  Amino sugar and nucleotide sugar metabolism
isc00531  Glycosaminoglycan degradation
isc00603  Glycosphingolipid biosynthesis - globo and isoglobo series
isc00604  Glycosphingolipid biosynthesis - ganglio series
isc01100  Metabolic pathways
isc04142  Lysosome
Module
isc_M00079  Keratan sulfate degradation
Brite
KEGG Orthology (KO) [BR:isc00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    IscW_ISCW004208
  Glycan biosynthesis and metabolism
   00531 Glycosaminoglycan degradation
    IscW_ISCW004208
   00603 Glycosphingolipid biosynthesis - globo and isoglobo series
    IscW_ISCW004208
   00604 Glycosphingolipid biosynthesis - ganglio series
    IscW_ISCW004208
   00511 Other glycan degradation
    IscW_ISCW004208
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    IscW_ISCW004208
Enzymes [BR:isc01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     IscW_ISCW004208
Chaperones and folding catalysts [BR:isc03110]
 Intramolecular chaperones
  Others
   IscW_ISCW004208
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_20 Glycohydro_20b2
Motif
Other DBs
NCBI-GeneID: 8028558
NCBI-ProteinID: XP_002400043
VectorBase: ISCW004208
UniProt: B7PE53
AA seq 522 aa AA seqDB search
MALFPPLQVTPTQGQAWPYPKEIQTGLEVFLIDPKSFQLVLRTPQGAPCELASSALRRYN
PSLLFGGCTTRSGVHSRCAPKGRRAEASSSSVIGQLLQLDVFLTGQCEGMPHFSMDENYL
TVALQSRAALQARSVWGIIRGLETFSQLVYPFNNTHFAVNRTEINDAPRFSHRGLLIDTS
RHFLPLHSIIDTLDAMAYNKMNVLHWHIVDDQSFPFVSRTFPGLSDFVSALYFALSTSFL
TLLRTAAFMRMALDVPAGHTQSWGAAFPDLLTPCYKGSTPNGKLGPMNPILNTTYQFLKY
FFEEVVDVFPDQYLHLGGDEVPFNCWKSNPNITEFMKKVKITGQYQKLEEYYIQKLLEIV
QGLRKSYIVWQEVVDNGVQVAPDTVVHVWKQPQETELTMVTARGYQALLSSCWYLDYISY
GSDWKKYYVCDPQRFDGTASQKALVLGGEACIWGEWVDATNIISRTWPRASAVAERLWSP
ATLTDPEAAVERFEEHRCRMIRRGLHAEPSNGPGYCECDHLL
NT seq 1569 nt NT seq  +upstreamnt  +downstreamnt
atggccttgttcccaccattgcaggttaccccgacgcagggccaagcgtggccttatccg
aaggaaattcaaaccgggctcgaggtctttcttatagaccccaagagcttccagctggtc
ctgcgaaccccccagggggccccgtgtgaactggcgtcgagcgccctccgccgatacaac
ccgtccctcctcttcggcggctgcaccacgagaagtggcgtccacagccgctgtgcccca
aaaggcagacgggccgaggcctcctcgtcgtccgtgatcgggcagctgctacagcttgac
gtcttcctgactgggcagtgcgagggcatgccccacttcagcatggacgagaactacctg
accgtggcgctccagtcgcgagctgccctgcaagccaggtccgtctggggaatcatcagg
ggactggagaccttcagccagcttgtctatccgttcaacaatacacactttgccgtaaac
cggaccgaaatcaacgacgcaccgaggttctctcatcggggccttctcatcgacacgtcc
aggcactttctaccgctgcattccatcatcgacaccttggacgcgatggcttacaacaaa
atgaacgtgcttcattggcatattgtggacgatcagtccttccccttcgtcagcaggacg
ttccccggactcagcgacttcgtaagtgctctctatttcgccctttcgacttcatttctg
acccttctgagaactgcggcattcatgagaatggcgctcgatgttcccgcaggccacacg
cagtcgtggggtgcggcgtttcctgatcttctgaccccgtgctacaagggcagcaccccc
aatggcaagttggggcccatgaatccgattctgaacaccacctaccagttcctgaagtac
ttcttcgaggaagtcgtggacgtgttccccgaccagtaccttcatctcggtggggacgaa
gtgcccttcaactgctggaaatctaatccaaacataaccgaatttatgaagaaggtcaag
attacaggacagtatcagaagctcgaggaatattatattcaaaagctgttggagattgtt
caagggttgcgcaagagttacattgtctggcaagaagtcgttgataacggcgttcaggtg
gctccagacacggtggtccacgtgtggaagcagccccaggagacggagctgacgatggtg
actgcgcgcggataccaggccctgctctcctcctgttggtacctggactacatatcatac
ggcagcgactggaagaagtactacgtctgcgaccctcagcgcttcgacggaactgcttcc
cagaaggcattggtgctcggcggtgaagcgtgcatatggggcgagtgggttgacgccacc
aacatcatcagccgaacctggccccgagcttctgcggtcgctgaacgactctggagtccc
gccacgctgacggatcccgaggccgcggtggagaggttcgaggaacaccgctgcaggatg
atcaggcgaggtctccatgctgagccctcaaacggccctgggtactgcgagtgcgatcat
ctgttgtag

DBGET integrated database retrieval system