KEGG   Ixodes scapularis (black-legged tick): IscW_ISCW004208Help
Entry
IscW_ISCW004208   CDS       T01131                                 

Definition
beta-N-acetylhexosaminidase, putative (EC:3.2.1.52)
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
isc  Ixodes scapularis (black-legged tick)
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Glycosaminoglycan degradation
Glycosphingolipid biosynthesis - globo series
Glycosphingolipid biosynthesis - ganglio series
Metabolic pathways
Lysosome
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:isc00520]
Metabolism; Glycan biosynthesis and metabolism; Glycosaminoglycan degradation [PATH:isc00531]
Metabolism; Glycan biosynthesis and metabolism; Glycosphingolipid biosynthesis - globo series [PATH:isc00603]
Metabolism; Glycan biosynthesis and metabolism; Glycosphingolipid biosynthesis - ganglio series [PATH:isc00604]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:isc00511]
Cellular Processes; Transport and catabolism; Lysosome [PATH:isc04142]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 522 aa AA seqDB search
MALFPPLQVTPTQGQAWPYPKEIQTGLEVFLIDPKSFQLVLRTPQGAPCELASSALRRYN
PSLLFGGCTTRSGVHSRCAPKGRRAEASSSSVIGQLLQLDVFLTGQCEGMPHFSMDENYL
TVALQSRAALQARSVWGIIRGLETFSQLVYPFNNTHFAVNRTEINDAPRFSHRGLLIDTS
RHFLPLHSIIDTLDAMAYNKMNVLHWHIVDDQSFPFVSRTFPGLSDFVSALYFALSTSFL
TLLRTAAFMRMALDVPAGHTQSWGAAFPDLLTPCYKGSTPNGKLGPMNPILNTTYQFLKY
FFEEVVDVFPDQYLHLGGDEVPFNCWKSNPNITEFMKKVKITGQYQKLEEYYIQKLLEIV
QGLRKSYIVWQEVVDNGVQVAPDTVVHVWKQPQETELTMVTARGYQALLSSCWYLDYISY
GSDWKKYYVCDPQRFDGTASQKALVLGGEACIWGEWVDATNIISRTWPRASAVAERLWSP
ATLTDPEAAVERFEEHRCRMIRRGLHAEPSNGPGYCECDHLL
NT seq 1569 nt NT seq  +upstreamnt  +downstreamnt
atggccttgttcccaccattgcaggttaccccgacgcagggccaagcgtggccttatccg
aaggaaattcaaaccgggctcgaggtctttcttatagaccccaagagcttccagctggtc
ctgcgaaccccccagggggccccgtgtgaactggcgtcgagcgccctccgccgatacaac
ccgtccctcctcttcggcggctgcaccacgagaagtggcgtccacagccgctgtgcccca
aaaggcagacgggccgaggcctcctcgtcgtccgtgatcgggcagctgctacagcttgac
gtcttcctgactgggcagtgcgagggcatgccccacttcagcatggacgagaactacctg
accgtggcgctccagtcgcgagctgccctgcaagccaggtccgtctggggaatcatcagg
ggactggagaccttcagccagcttgtctatccgttcaacaatacacactttgccgtaaac
cggaccgaaatcaacgacgcaccgaggttctctcatcggggccttctcatcgacacgtcc
aggcactttctaccgctgcattccatcatcgacaccttggacgcgatggcttacaacaaa
atgaacgtgcttcattggcatattgtggacgatcagtccttccccttcgtcagcaggacg
ttccccggactcagcgacttcgtaagtgctctctatttcgccctttcgacttcatttctg
acccttctgagaactgcggcattcatgagaatggcgctcgatgttcccgcaggccacacg
cagtcgtggggtgcggcgtttcctgatcttctgaccccgtgctacaagggcagcaccccc
aatggcaagttggggcccatgaatccgattctgaacaccacctaccagttcctgaagtac
ttcttcgaggaagtcgtggacgtgttccccgaccagtaccttcatctcggtggggacgaa
gtgcccttcaactgctggaaatctaatccaaacataaccgaatttatgaagaaggtcaag
attacaggacagtatcagaagctcgaggaatattatattcaaaagctgttggagattgtt
caagggttgcgcaagagttacattgtctggcaagaagtcgttgataacggcgttcaggtg
gctccagacacggtggtccacgtgtggaagcagccccaggagacggagctgacgatggtg
actgcgcgcggataccaggccctgctctcctcctgttggtacctggactacatatcatac
ggcagcgactggaagaagtactacgtctgcgaccctcagcgcttcgacggaactgcttcc
cagaaggcattggtgctcggcggtgaagcgtgcatatggggcgagtgggttgacgccacc
aacatcatcagccgaacctggccccgagcttctgcggtcgctgaacgactctggagtccc
gccacgctgacggatcccgaggccgcggtggagaggttcgaggaacaccgctgcaggatg
atcaggcgaggtctccatgctgagccctcaaacggccctgggtactgcgagtgcgatcat
ctgttgtag

DBGET integrated database retrieval system