KEGG   Ixodes scapularis (black-legged tick): IscW_ISCW004208Help
Entry
IscW_ISCW004208   CDS       T01131                                 

Definition
beta-N-acetylhexosaminidase, putative (EC:3.2.1.52)
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
isc  Ixodes scapularis (black-legged tick)
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Glycosaminoglycan degradation
Glycosphingolipid biosynthesis - globo series
Glycosphingolipid biosynthesis - ganglio series
Metabolic pathways
Lysosome
Brite
KEGG Orthology (KO) [BR:isc00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    IscW_ISCW004208
  Glycan biosynthesis and metabolism
   00531 Glycosaminoglycan degradation
    IscW_ISCW004208
   00603 Glycosphingolipid biosynthesis - globo series
    IscW_ISCW004208
   00604 Glycosphingolipid biosynthesis - ganglio series
    IscW_ISCW004208
   00511 Other glycan degradation
    IscW_ISCW004208
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    IscW_ISCW004208
Enzymes [BR:isc01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     IscW_ISCW004208
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 522 aa AA seqDB search
MALFPPLQVTPTQGQAWPYPKEIQTGLEVFLIDPKSFQLVLRTPQGAPCELASSALRRYN
PSLLFGGCTTRSGVHSRCAPKGRRAEASSSSVIGQLLQLDVFLTGQCEGMPHFSMDENYL
TVALQSRAALQARSVWGIIRGLETFSQLVYPFNNTHFAVNRTEINDAPRFSHRGLLIDTS
RHFLPLHSIIDTLDAMAYNKMNVLHWHIVDDQSFPFVSRTFPGLSDFVSALYFALSTSFL
TLLRTAAFMRMALDVPAGHTQSWGAAFPDLLTPCYKGSTPNGKLGPMNPILNTTYQFLKY
FFEEVVDVFPDQYLHLGGDEVPFNCWKSNPNITEFMKKVKITGQYQKLEEYYIQKLLEIV
QGLRKSYIVWQEVVDNGVQVAPDTVVHVWKQPQETELTMVTARGYQALLSSCWYLDYISY
GSDWKKYYVCDPQRFDGTASQKALVLGGEACIWGEWVDATNIISRTWPRASAVAERLWSP
ATLTDPEAAVERFEEHRCRMIRRGLHAEPSNGPGYCECDHLL
NT seq 1569 nt NT seq  +upstreamnt  +downstreamnt
atggccttgttcccaccattgcaggttaccccgacgcagggccaagcgtggccttatccg
aaggaaattcaaaccgggctcgaggtctttcttatagaccccaagagcttccagctggtc
ctgcgaaccccccagggggccccgtgtgaactggcgtcgagcgccctccgccgatacaac
ccgtccctcctcttcggcggctgcaccacgagaagtggcgtccacagccgctgtgcccca
aaaggcagacgggccgaggcctcctcgtcgtccgtgatcgggcagctgctacagcttgac
gtcttcctgactgggcagtgcgagggcatgccccacttcagcatggacgagaactacctg
accgtggcgctccagtcgcgagctgccctgcaagccaggtccgtctggggaatcatcagg
ggactggagaccttcagccagcttgtctatccgttcaacaatacacactttgccgtaaac
cggaccgaaatcaacgacgcaccgaggttctctcatcggggccttctcatcgacacgtcc
aggcactttctaccgctgcattccatcatcgacaccttggacgcgatggcttacaacaaa
atgaacgtgcttcattggcatattgtggacgatcagtccttccccttcgtcagcaggacg
ttccccggactcagcgacttcgtaagtgctctctatttcgccctttcgacttcatttctg
acccttctgagaactgcggcattcatgagaatggcgctcgatgttcccgcaggccacacg
cagtcgtggggtgcggcgtttcctgatcttctgaccccgtgctacaagggcagcaccccc
aatggcaagttggggcccatgaatccgattctgaacaccacctaccagttcctgaagtac
ttcttcgaggaagtcgtggacgtgttccccgaccagtaccttcatctcggtggggacgaa
gtgcccttcaactgctggaaatctaatccaaacataaccgaatttatgaagaaggtcaag
attacaggacagtatcagaagctcgaggaatattatattcaaaagctgttggagattgtt
caagggttgcgcaagagttacattgtctggcaagaagtcgttgataacggcgttcaggtg
gctccagacacggtggtccacgtgtggaagcagccccaggagacggagctgacgatggtg
actgcgcgcggataccaggccctgctctcctcctgttggtacctggactacatatcatac
ggcagcgactggaagaagtactacgtctgcgaccctcagcgcttcgacggaactgcttcc
cagaaggcattggtgctcggcggtgaagcgtgcatatggggcgagtgggttgacgccacc
aacatcatcagccgaacctggccccgagcttctgcggtcgctgaacgactctggagtccc
gccacgctgacggatcccgaggccgcggtggagaggttcgaggaacaccgctgcaggatg
atcaggcgaggtctccatgctgagccctcaaacggccctgggtactgcgagtgcgatcat
ctgttgtag

DBGET integrated database retrieval system