KEGG   Ixodes scapularis (black-legged tick): IscW_ISCW004359Help
Entry
IscW_ISCW004359   CDS       T01131                                 

Definition
D-amino acid oxidase, putative (EC:1.4.3.1)
Orthology
K00273  
D-amino-acid oxidase [EC:1.4.3.3]
Organism
isc  Ixodes scapularis (black-legged tick)
Pathway
Glycine, serine and threonine metabolism
Arginine and proline metabolism
D-Arginine and D-ornithine metabolism
Metabolic pathways
Peroxisome
Class
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:isc00260]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:isc00330]
Metabolism; Metabolism of other amino acids; D-Arginine and D-ornithine metabolism [PATH:isc00472]
Metabolism; Biosynthesis of other secondary metabolites; Penicillin and cephalosporin biosynthesis
Cellular Processes; Transport and catabolism; Peroxisome [PATH:isc04146]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 337 aa AA seqDB search
MGPRVAVIGAGIIGMTTALRASETCPDAIIDVIAEKFTPHTTGDVAAGLFKPYIIKGVPE
EKMRQWCLDSFAFYSNLLKREDSGRLGLSLMPAYLLSKHSTPRPLHADAFLHYRDVTDKE
LKNFPSNYKFGSYIISMTIECKKLLPHLMKWFLKRGGRFIEKKVKNLEELFQTYDVIFNC
TGVGALFLTPDVELQPVRGHLIRVRAPWIKYAIMGDDDVYIIPNIDEVVLGTTAEVGNFS
LIPNEETHKKIWERCVNVLPSLKTAEIITDTVGLRPGRTSVRIEREDRIVEETGKTVTII
HNYGHGGSGVTLSWGCACDAVKIVEDVLCESRRTGGV
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgggacccagggtcgccgtcattggggctggaatcattggcatgaccacggccctgaga
gcttcggaaacgtgtcccgatgcgatcatcgacgttatcgccgaaaaattcaccccacat
acaacaggtgacgtcgcggcaggtctcttcaaaccttacataatcaagggcgttccagag
gaaaaaatgaggcagtggtgtttagacagctttgccttctacagcaatctactaaaacgt
gaagattctggtaggcttgggctatcacttatgcctgcatacctcctaagtaaacattcg
acgccaagaccgctgcacgctgatgcatttttgcactacagagacgtgacagataaagaa
ttgaagaattttccgagcaactacaagttcggaagctacattatctcaatgacaattgaa
tgcaagaaacttctgccacaccttatgaaatggttcttgaagaggggaggtcgtttcata
gagaagaaagtaaagaatctcgaggagcttttccaaacatatgacgtcatttttaattgt
acgggagtcggagcattgttcctcacccctgatgttgaattacagcccgttcggggacat
ctaattagggtgcgcgcaccatggatcaagtacgctatcatgggtgatgacgacgtctat
atcattcctaacatcgatgaagtggtgctcggaacaactgcagaggttggaaacttcagt
ttgattccaaacgaagaaactcacaagaagatatgggagcgctgcgtcaacgtcttgcca
agcttaaagacagctgaaataatcaccgataccgtggggctacgacctggaagaacctct
gtacggatcgagagagaagaccgtatcgtcgaagaaacaggaaaaacggtgacgattatc
cacaactacggacacggcggctcgggcgtgactctttcttggggctgcgcttgcgacgcc
gtgaagatcgtcgaagacgtcctttgcgaaagccgtcgcaccggtggagtatga

DBGET integrated database retrieval system