KEGG   Ixodes scapularis (black-legged tick): IscW_ISCW004359Help
Entry
IscW_ISCW004359   CDS       T01131                                 

Definition
D-amino acid oxidase, putative (EC:1.4.3.1)
Orthology
K00273  
D-amino-acid oxidase [EC:1.4.3.3]
Organism
isc  Ixodes scapularis (black-legged tick)
Pathway
Glycine, serine and threonine metabolism
Arginine and proline metabolism
D-Arginine and D-ornithine metabolism
Metabolic pathways
Peroxisome
Brite
KEGG Orthology (KO) [BR:isc00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    IscW_ISCW004359
   00330 Arginine and proline metabolism
    IscW_ISCW004359
  Metabolism of other amino acids
   00472 D-Arginine and D-ornithine metabolism
    IscW_ISCW004359
  Biosynthesis of other secondary metabolites
   00311 Penicillin and cephalosporin biosynthesis
    IscW_ISCW004359
 Cellular Processes
  Transport and catabolism
   04146 Peroxisome
    IscW_ISCW004359
Enzymes [BR:isc01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.3  With oxygen as acceptor
    1.4.3.3  D-amino-acid oxidase
     IscW_ISCW004359
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 337 aa AA seqDB search
MGPRVAVIGAGIIGMTTALRASETCPDAIIDVIAEKFTPHTTGDVAAGLFKPYIIKGVPE
EKMRQWCLDSFAFYSNLLKREDSGRLGLSLMPAYLLSKHSTPRPLHADAFLHYRDVTDKE
LKNFPSNYKFGSYIISMTIECKKLLPHLMKWFLKRGGRFIEKKVKNLEELFQTYDVIFNC
TGVGALFLTPDVELQPVRGHLIRVRAPWIKYAIMGDDDVYIIPNIDEVVLGTTAEVGNFS
LIPNEETHKKIWERCVNVLPSLKTAEIITDTVGLRPGRTSVRIEREDRIVEETGKTVTII
HNYGHGGSGVTLSWGCACDAVKIVEDVLCESRRTGGV
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgggacccagggtcgccgtcattggggctggaatcattggcatgaccacggccctgaga
gcttcggaaacgtgtcccgatgcgatcatcgacgttatcgccgaaaaattcaccccacat
acaacaggtgacgtcgcggcaggtctcttcaaaccttacataatcaagggcgttccagag
gaaaaaatgaggcagtggtgtttagacagctttgccttctacagcaatctactaaaacgt
gaagattctggtaggcttgggctatcacttatgcctgcatacctcctaagtaaacattcg
acgccaagaccgctgcacgctgatgcatttttgcactacagagacgtgacagataaagaa
ttgaagaattttccgagcaactacaagttcggaagctacattatctcaatgacaattgaa
tgcaagaaacttctgccacaccttatgaaatggttcttgaagaggggaggtcgtttcata
gagaagaaagtaaagaatctcgaggagcttttccaaacatatgacgtcatttttaattgt
acgggagtcggagcattgttcctcacccctgatgttgaattacagcccgttcggggacat
ctaattagggtgcgcgcaccatggatcaagtacgctatcatgggtgatgacgacgtctat
atcattcctaacatcgatgaagtggtgctcggaacaactgcagaggttggaaacttcagt
ttgattccaaacgaagaaactcacaagaagatatgggagcgctgcgtcaacgtcttgcca
agcttaaagacagctgaaataatcaccgataccgtggggctacgacctggaagaacctct
gtacggatcgagagagaagaccgtatcgtcgaagaaacaggaaaaacggtgacgattatc
cacaactacggacacggcggctcgggcgtgactctttcttggggctgcgcttgcgacgcc
gtgaagatcgtcgaagacgtcctttgcgaaagccgtcgcaccggtggagtatga

DBGET integrated database retrieval system