KEGG   Ixodes scapularis (black-legged tick): IscW_ISCW005210Help
Entry
IscW_ISCW005210   CDS       T01131                                 

Definition
dehydrogenase kinase, putative (EC:2.7.11.4)
Orthology
K00905  
[3-methyl-2-oxobutanoate dehydrogenase (acetyl-transferring)] kinase [EC:2.7.11.4]
Organism
isc  Ixodes scapularis (black-legged tick)
Brite
Enzymes [BR:isc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.4  [3-methyl-2-oxobutanoate dehydrogenase (acetyl-transferring)] kinase
     IscW_ISCW005210
Protein kinases [BR:isc01001]
 Serine/threonine protein kinases: Atypical group
  PDHK family [OT]
   IscW_ISCW005210
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 413 aa AA seqDB search
MATALERNLVLGGTLKQRCRALLPTRGIAYSSKGAAEASPQPRDKSRTVQSFYNQSAIDV
AAAKPSVRLTPTTILYSGKSPDGSHLLRSAQYLHKELPVRIAHRIAGFRSLPFIVGCNPT
ILAVHELYTQTFYLLTDFPPVTDFESESRYSETVQQVLDDHKDVVTQLAAGFKECRKHIK
QEELVKTFLDRTLTSRLGMRMLAEHHIALRQDRPNHVGIINTAMRPKEVIEKWADFVKQV
AVHKYGKSPPIKYNGHLTCSFPYIQLPLDYIIPELLKNAVRATVENHPDNPESSLPPVTV
TIANNDVDFIIRISDRGGGIEHEHLGQIMQYHFSTASSYEGQYDGGLLGTMMTQPMDGPA
GGPMHGFGFGLPTSRAYAEYLGGTLTFETLQGIGTDVYLRLRHIDGKYESFRI
NT seq 1242 nt NT seq  +upstreamnt  +downstreamnt
atggcaaccgctctggagcgaaatctggtgctcggggggactctgaagcagcgctgcaga
gcgctgcttccgacgagaggcatcgcgtactcgtcgaaaggagccgccgaggcgagcccg
caacccagagacaaatcgcggaccgtgcagtctttctacaaccagtccgcgatcgacgtt
gctgctgccaagccctctgttcgtctgacgcccaccaccatactatattctggcaagtca
cctgatggcagccaccttctgcgcagtgcccaatacttgcacaaggagcttcccgtgcgc
attgcacaccgcatcgccggcttccgcagccttcccttcatcgtcgggtgcaaccccacc
atcctggccgtgcatgagctctacactcaaacgttttacctcctgactgattttcctccg
gtgacggactttgagtccgagagccgctactcggagacggtgcagcaggtcctggacgac
cacaaggacgtggtgacgcagctggcagccggcttcaaggagtgccgcaagcacatcaag
caagaagagctggtgaagacgttcctggaccgcaccttgacgtcgcggctgggaatgcgg
atgctggcggagcaccacatcgcgctgcgccaggacaggcccaaccatgtggggatcatc
aacacggcaatgcgtcccaaggaagtgatcgagaaatgggcagactttgtcaaacaggtg
gcggtgcacaagtatggcaagtcgcctcccatcaagtacaacggccacctgacatgcagc
tttccctacatccagttgcccctggactacattatcccagagctgctcaagaacgcagtc
agggccacggtggagaaccacccggacaacccagagtcgagcctgcccccggtgacggtc
accatagccaacaacgacgtggacttcatcatcaggatctccgaccggggcggcggcatc
gagcacgagcacctggggcagatcatgcaataccatttctcgacggccagctcatacgag
gggcagtacgacggtggcctgctgggcacgatgatgacgcagccaatggacggccccgca
gggggccccatgcacgggttcggctttggactgccgacgtcgcgcgcctacgccgagtac
ctcggcggcaccctcaccttcgagacgctccagggtatcgggacggacgtgtacctgagg
ctgcgccacatcgacggcaaatacgagagcttccgcatctga

DBGET integrated database retrieval system