KEGG   Ixodes scapularis (black-legged tick): IscW_ISCW005337Help
Entry
IscW_ISCW005337   CDS       T01131                                 

Definition
hypothetical protein
Orthology
K11848  
ubiquitin carboxyl-terminal hydrolase 20/33 [EC:3.1.2.15]
Organism
isc  Ixodes scapularis (black-legged tick)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 830 aa AA seqDB search
MAGNSGGALSACPHVTTVGDFTKEDIARKQEWRCESCGASGPSLWACLYRDCLYVGCGEA
FKDHSTLHFQGCCEHSVTLNLSTLRVWCYLCESEVFLENNRPPLLGASPRSNRTLPQGTA
HAPAGAARVPQGASSPAQDPDSDDEADQENGLKPRGLTGLQNLGNTCYMNAALQALSNCP
QLTNFFLDCGSLVPSSKKPGLSKSYMRLVREMWHKRRPSYVVPSGIAYGIKLVCPVFRGY
SQQVGRPRSPPVATSDSSPSEDEGDEEEEDFETCDSGLSSEKSSCGEEGASDLRLLAPSH
DRLAKEGLGRLAPVEEKAGGDWPQEPHDHSSGAKQSPAAVAPRARRGRRGASHRLRSVVS
DVFDGRILSSVQCLTCDTVSTTRETFQDLSLPIPGRDHLAVLHAAAAAGGQGGSSPHGTS
RGPPMDPTASQSWLSWLLTRMFSWVFGWLWGPGVGLQDCLAAFFSADELKGDNMYSCEKC
RKLRNGIKFSRVLQLPEVLCIHLKRFRHEVMFSSKIGSYVSFPLDGLDMSPFLHRECPRT
STIYDLMAVICHHGTAGSGHYTTYALNHLNDQWYEFDDQYVTSVEPQVVQNCEAYVLFYR
KSSEEMVNRRNRTFELMERSRNEPGLLSFYISKQWVNRFNTFADPGPIDNGDFLCVHGGG
SACTHLYTCPTCTSEREALESRRKLELETFLALNREFQQSQESPGEVYAVSMAWFKQWEA
FVRGKETDAPGPIDNWCICGVTAKSASTAQTLQQSLRAGSDYGSLSEPMWRFLQGSYGGG
PEVPLQQAQPVVQAAVRPTYPTRPPASPSQALGPAAAKRPCMEEPKEESQ
NT seq 2493 nt NT seq  +upstreamnt  +downstreamnt
atggctggcaacagcggcggcgctctcagtgcctgtcctcacgtcaccactgtgggtgac
ttcaccaaggaggacatcgcaaggaagcaggagtggcggtgcgaatcatgtggagccagt
ggccccagcttatgggcctgcctgtaccgggactgcctctatgtgggctgtggagaggcc
ttcaaggaccacagcaccctgcattttcagggctgctgcgagcactcggtgactctgaac
ctgagcaccctgagggtctggtgctacctgtgcgagagcgaggtgttcctggagaacaac
cggccgcccctgttgggcgcctccccgcgcagcaacaggaccctcccccaggggacggcc
cacgcccctgcgggggccgcacgcgttccccagggggcctcgtccccggcccaggatcca
gactccgacgacgaggctgaccaagaaaacggactcaagcccagagggctaacagggctg
cagaatttgggcaacacatgctacatgaatgcagcgcttcaggctctgtcaaattgcccc
cagctgaccaacttcttcctggactgcgggagcttggttccttcgagcaaaaagcctggc
ctgtccaagagctacatgcgcctggtgcgcgagatgtggcacaagcggagacccagctat
gtcgtgccctcgggcatcgcttacggaatcaaactggtctgtcctgtgttccgtggctac
agccaacaggtggggcgaccccggtcccctcccgtggccacctcggactcgagtccctca
gaggacgagggggacgaggaggaggaagacttcgagacgtgcgactctggcctgagcagc
gagaagagctcgtgcggggaggaaggggcctccgacctcaggctcctcgccccttcgcac
gaccgcctggcaaaggagggtctgggccggttggcgcccgtcgaggaaaaggcgggcggg
gactggccccaggagccccacgaccacagcagcggggccaagcagagtccggcggcggtg
gcaccccgggctcgcagggggcgccggggggcctctcacaggctgcgcagcgtcgtctcg
gacgtctttgacggccgcatcctcagctctgtgcagtgcctcacctgcgacacggtgtcg
acgacgcgagagacgttccaggacctgtccctgcccatcccaggcagggaccacctggcg
gtgctgcatgcggctgcggcggccggcggccagggggggagcagcccccacgggactagc
aggggtccccccatggacccgaccgcctcccagagctggctctcctggctgctcacgcgc
atgttctcttgggttttcgggtggctgtggggcccaggggtggggctgcaggactgcctc
gcggcctttttctcggccgacgaactcaagggggacaacatgtacagctgtgagaagtgc
cgcaagctgcgcaacggcattaagttctcacgggtgcttcagctcccagaggtgctgtgc
atccacctgaagcgatttcggcacgaggtcatgttttcttctaagatcggcagttacgtc
tccttccccctggatggattggacatgtccccgtttcttcatcgagaatgcccccggacg
agcacaatctacgacctgatggccgtcatctgtcaccacggcactgccggctcggggcac
tacacgacgtatgccttgaaccacctgaacgaccagtggtacgagtttgacgaccagtac
gtcacctcggtggaaccgcaggtagtgcagaactgcgaggcctacgtgctcttctatcgg
aagtcctcggaggagatggtgaaccgcaggaaccgcaccttcgagctcatggagcgcagc
cgcaatgagccgggactgctgagcttctacatctcgaagcagtgggtgaatcggttcaat
accttcgccgatcctggccccatcgacaacggggacttcctctgtgtgcacggaggcggt
tccgcctgcactcacctgtacacctgccccacgtgcacgagcgagcgggaggctctggag
agcaggagaaagctcgaactggagacctttttggcgttgaaccgcgagttccagcaaagc
caagagagccctggagaggtgtatgccgtgagcatggcgtggttcaagcagtgggaggcc
tttgtgaggggcaaagagacagacgccccaggtcccatcgacaactggtgcatttgcggg
gtgactgccaagtctgcatccaccgcacaaaccctacaacagtccctgcgtgcgggcagc
gactacggctccctgtctgagccgatgtggcgcttcttgcaaggtagctacggagggggc
cccgaggtgcccctgcagcaggcccagcccgtggtgcaggcagcagtgcgccccacctac
cccacaagaccccccgcctcccctagtcaagccttgggcccagctgcagccaagcggcct
tgcatggaggagcccaaagaagagagccagtag

DBGET integrated database retrieval system