KEGG   Ixodes scapularis (black-legged tick): IscW_ISCW005340Help
Entry
IscW_ISCW005340   CDS       T01131                                 

Definition
(RefSeq) retinoid X receptor, putative
  KO
K08524  retinoid X receptor alpha
Organism
isc  Ixodes scapularis (black-legged tick)
Brite
Transcription factors [BR:isc03000]
 Eukaryotic Type
  Zinc finger
   Cys4 hepatocyte nuclear factor 4-like
    IscW_ISCW005340
Nuclear receptors [BR:isc03310]
 2. Hepatocyte nuclear factor 4 like
  2B. Retinoid X receptor (RXR)
   IscW_ISCW005340
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hormone_recep zf-C4 C1_2
Motif
Other DBs
NCBI-GeneID: 8051436
NCBI-ProteinID: XP_002435070
VectorBase: ISCW005340
UniProt: B7PMS2
AA seq 400 aa AA seqDB search
VAYAAPSAGLNGSPSSNGVSSSLAQPSFLLGGYGGGGGGGAPSSVSQRGDPRALVDPGPA
FAQGGSSRYPPNHPLSGSKHLCSICGDRASGKHYGVYSCEGCKGFFKRTVRKDLTYACRE
ERNCIIDKRQRNRCQYCRYQKCLSCGMKREAVQEERQRTKDRADNEVESTSGGAPAEMPL
ERILEAELRVEPKGGSAPESQDPVSSICQAADRQLHQLVEWAKHIPHFVELPLEDRMVLL
KAGWNELLIAAFSHRSIGVRDGIVLATGLVVQRHSAHGAGVGAIFDRVLTELVAKMREMK
MDRTELGCLRAVVLFNPEAKGLRSTAQVEALREKVYAALEEHCRQQYPEQPGRFAKLLLR
LPALRSIGLKCLEHLFFFKLIGDTPIDNFLLSMLEAPSDA
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
gttgcttacgcagcgccctcggcgggcctcaacggcagtccctcgtccaacggcgtgagc
agcagcctcgcccagccgtccttcctgctgggcggctacggcggcggcggtggcggcggg
gccccgagctcggtgagccagcgcggcgatccgcgggccctggttgacccggggcccgca
ttcgcgcagggcggctcttcgcgctacccgcccaaccatcccctcagtgggtccaaacac
ctctgctccatctgtggcgacagggcgtcggggaagcactacggcgtgtacagttgcgag
ggctgcaagggcttcttcaagcggacggtgcgcaaggacctgacgtacgcgtgccgggag
gagcgcaactgcatcatagacaagcggcagcgcaaccggtgccagtactgtcggtaccag
aaatgcctgtcgtgcggcatgaagcgggaggcggtgcaggaggagcggcagcgcaccaag
gaccgggccgacaacgaggtggagagcacgagtggcggcgccccggcggagatgccgctg
gagcgcatcctagaggcggagctgcgggtggagcccaaggggggctctgccccagagtcc
caggaccctgtgagcagcatctgccaggcggccgaccgccagctgcaccagctggtcgag
tgggccaagcacatccctcactttgtggagctgcccctggaggaccgcatggtgcttctc
aaggctggctggaacgagctgctcatcgcggccttctcgcaccgctccattggcgtgcgg
gacggcattgtgctggccacaggcctggtggtgcagcgccacagtgcccacggggcaggc
gtgggcgccatctttgacagggtgctcaccgagctcgtggccaagatgcgcgagatgaag
atggaccgcacggagctgggctgtctccgggccgtcgtgctctttaacccggaggccaaa
ggcctgcgcagcactgcccaggtggaggccctcagggagaaggtttatgcggcgctggag
gagcactgccggcagcagtacccagagcagccgggccgctttgccaagctgctgctgcgg
ctgcctgcgctgcgcagcatcggcctcaagtgcctcgagcacctgttcttcttcaagctc
attggggacacccccatcgacaacttcctcctctccatgctcgaggccccctcggatgcc
tga

DBGET integrated database retrieval system