KEGG   Ixodes scapularis (black-legged tick): IscW_ISCW005428Help
Entry
IscW_ISCW005428   CDS       T01131                                 

Definition
mitogen-activated protein kinase kinase MKK4, putative (EC:2.7.12.2)
Orthology
K04368  
mitogen-activated protein kinase kinase 1 [EC:2.7.12.2]
Organism
isc  Ixodes scapularis (black-legged tick)
Pathway
FoxO signaling pathway
Dorso-ventral axis formation
Brite
KEGG Orthology (KO) [BR:isc00001]
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    IscW_ISCW005428
 Organismal Systems
  Development
   04320 Dorso-ventral axis formation
    IscW_ISCW005428
Enzymes [BR:isc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     IscW_ISCW005428
Protein kinases [BR:isc01001]
 Serine/threonine protein kinases: STE group
  STE7 family
   IscW_ISCW005428
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 385 aa AA seqDB search
LSANDEVTTTFPCSKSTLDTSMEALQKTLEGLELDEQQRKRLEAFLSQKQKVGELSSDDF
ENLGELGAGNGGVVTKVLHRPSGLVMARKLIHLEVKPAIRNQIIRELKVLHECNSPHIVG
FYGAFYSDGEINVCMEYMDGGSLDLVLKKADRIPENILGKVTIAVLKGLNYLREKHQIMH
RDVKPSNMLVNSRGEIKICDFGVSGQLIDSMANSFVGTRSYMSPERLQGTHYTVQSDIWS
LGLSLVEMALGRYPIPPPNDKELTAMFGRKYNPEGGPPYVPVSAGNSGMSSGDSTRAMSI
FELLDYIVNEAPPSVPTGVFSPEFKDLVDRCLKRNPNERGDLKTLMNHPYVRRWDQEKVD
FAGWVCTTMGLDPSTPTKLTPEGQA
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
ctttcggcgaatgacgaagtcacgacaacgtttccttgcagcaagtcgacactggacacg
agcatggaggcgctccagaagacgctggagggcctcgagctggacgagcagcagcgtaag
cgcctggaggccttcctctcgcagaagcagaaggtcggggagctgagcagcgacgacttc
gagaacctgggcgagctgggcgcgggcaacgggggcgtagtcaccaaagtgctgcaccgc
cccagcgggctcgtcatggccaggaagctgatccacctggaagtcaaacctgccattcgc
aaccagatcatacgggagctgaaggtcctgcacgagtgcaactctcctcacatcgtgggc
ttctatggggccttctacagcgacggggagatcaacgtctgcatggagtacatggatggt
ggttccctagacctcgttctgaagaaggccgatcgcattcccgaaaatattttgggcaaa
gtcacaatagcggtattgaaaggcctgaattatctgagagagaagcaccaaataatgcat
cgggacgtgaagccctcgaacatgttggtgaactcgaggggtgagatcaagatttgtgac
tttggggtgagcggacagctgatcgactccatggccaactcctttgtgggcacgcggtcc
tacatgtccccggaacggctccagggcacccactacacggtccagtcagacatttggagc
ctggggctgtcgctggttgaaatggcgctgggccggtacccgatcccgccccccaacgac
aaggagctcaccgccatgtttggccgaaagtacaaccccgaaggtgggccaccctatgtg
cctgtttctgcaggtaactccggtatgtcctctggcgacagtacgcgggccatgtccatc
ttcgaactcctcgactacattgtcaacgaagcgccaccgtcagtgcccaccggtgtcttc
tcaccggaattcaaggacttggtggaccgatgcctcaagagaaatccaaatgagaggggg
gacttgaagacgctcatgaaccacccgtacgtgcggaggtgggaccaggagaaagtggac
tttgcaggctgggtctgcactacgatggggctggacccgtcgaccccaaccaaactcaca
cccgagggacaggcctga

DBGET integrated database retrieval system