KEGG   Ixodes scapularis (black-legged tick): IscW_ISCW005592Help
Entry
IscW_ISCW005592   CDS       T01131                                 

Definition
ubiquitin specific protease, putative (EC:3.1.2.15 1.3.1.74)
Orthology
K11852  
ubiquitin carboxyl-terminal hydrolase 31 [EC:3.1.2.15]
Organism
isc  Ixodes scapularis (black-legged tick)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 884 aa AA seqDB search
MGGARKQLQYRSLRSLEDPGGAGSTSTTTKSTGSHRPKRPSLFDQLVRRFCTPAPRHLSK
GSHQQHYGPVRTGSLRDVRSRAVGGDPGDSRKDAFAARPDALKVVPAVAGLRNEGNTCFM
NAVLQCLSNSDAFAEYLVSERYRGDLLRKGGAGRSTSGSGGRVTEQLAQVIAALWRGRAD
ADVSARFKSVVEKHASQYQGSEQHDAQEFLMWLLDKVHEDLDAGDDGATGKRSHKRPKAA
AERFGSSRNARGSVPSSLPGEWQPRSPHPAPPASRWQGSRVASLFGGQLRLRLTCPRCGR
QSITFDPFLCLSLPIPVPQQWLCRLSFVPRNAPPLLLLEETKEGYGNLFSGDEPASGVPP
GARLVALELPSAKVTAATPKDALLLLLCRSRLGSSGPCLGATRAVWVPREVSYNELKSKV
VESLPSAGRSSLKDQGLENGFEVLAWDAQRTLPTDVDHPLFLEFVDHVLEAFRDVTPVPL
LRLLLRWEPRAADRLFLAEDSIAEEGADVSLEQESAPSVSLSDCLDFYFTEEKLEPDEAW
LCPQCESRQQGVAQLALSSCPDILVVHLKRFHQSGRHHGKLATRVEVTQNDLDLGPHLCQ
QGSGLRGAKYDLYALCSHHGAGLQGGHYTACCKNPVDGNWYLFDDARVRPATPEDLMARD
AYLLFYQRQNPDRKTGSGSSLGTTTSGHWFSHAPPLSSSRSHEQLLERSPVRRRETGSSP
VRAGTPPALPPPPTSYSVLPGGCSPSAGDGSPGSPAAPVRTNSLSRGEPQDTTPRASGPG
LQVSGLQVSGLQVSGLQAPSLRTSSMRNGVMRDGVMRDGVVRNGVMRNGVMRDGIMRDIT
VRDASLLPNMSQDKPTVEQCSPGDAGAEAQQPTHKEAFWTVTSV
NT seq 2655 nt NT seq  +upstreamnt  +downstreamnt
atggggggagcccgcaagcaactgcagtaccgaagtctgcggtccctcgaagaccccggc
ggcgcggggtcgacgtccaccacgaccaagtcgacggggtcgcatagacccaagcgaccc
agcctgttcgatcagctggttcggcggttctgcacgcccgcgccgcgtcacctctccaag
ggttcccaccagcagcactacggacccgtcagaacggggtcgcttcgcgacgtccggtcg
cgggcggtcggcggcgaccccggcgacagtcggaaggacgcgttcgcggccagaccggac
gcgcttaaggtcgttcccgcggtcgccggcctccggaacgaaggcaacacctgcttcatg
aacgctgtcctccagtgcctgagcaactccgacgccttcgcggagtacctggtgtccgaa
aggtaccgaggcgacttgctcaggaaggggggtgctggtcggtcgacgtcggggtctggt
ggtcgcgtcaccgaacagctagcgcaagtgatcgcggcgctgtggcgggggcgggcagac
gccgacgtctcggcccgcttcaagtctgtggtcgagaagcatgccagtcagtaccagggc
agcgagcagcacgacgcacaggagttcctcatgtggctgttggacaaggtgcacgaagac
ctggatgctggggacgacggtgccactggaaagcggtcgcacaagaggcccaaggctgcc
gctgagcgtttcggctcctcccgcaatgcccggggctccgttccgtcgtccctgcccggc
gagtggcagccgaggagcccgcaccctgcgcccccagcgagccgctggcagggcagccgg
gtggcgtcgctgttcgggggccagctgcggctgcgactgacgtgcccccgctgcggccgc
cagagcattaccttcgaccctttcctctgcctgtccctgcccatcccggtgccccagcag
tggctctgccggctcagcttcgtcccgcgcaacgcgccacccctcctgctgctggaagag
acgaaggaagggtacggaaacctgttctcgggggatgagcccgcgagcggggttccgccg
ggtgctcggctggtggccttggagcttccgtcggccaaggtcacggccgcaacccccaaa
gacgccctgcttctgctgctctgtcggtcccggctgggctcctctggaccctgcctcggc
gccacgcgggcggtctgggtgccgcgggaagtgtcgtacaacgagctcaagtccaaggtg
gtggagagtcttccctcagcgggccggagctccctcaaggaccagggtctggaaaatggc
ttcgaggtgctggcctgggacgcgcagcggacgcttccaacggacgtggaccacccgctc
tttctggagtttgtagaccacgtcctggaggccttccgggacgtgactccggtgccgctg
ctccgactgctgctccgctgggaaccacgtgcagccgaccgactcttcctcgcggaggat
tcaatcgccgaagaaggtgcggacgtgtccctggaacaggagtcggcgccctcagtgtcc
ctctccgattgcctcgacttctacttcaccgaggagaagctggaaccggacgaggcgtgg
ctgtgcccgcagtgcgagagcaggcagcagggtgtggcccagctggcactgtcctcctgc
ccagacatcctggtggtccacctcaagcgcttccatcagagcggacgccaccacggcaag
ctggcgacgcgggtggaggtgacccagaacgacctcgacctggggccccacctgtgccag
caggggtctgggcttcggggggccaagtacgacctgtacgccctgtgcagccaccacggg
gcaggcctgcagggagggcactacacggcgtgctgcaaaaacccagtggacgggaactgg
tacctattcgacgacgccagagtgcgccccgcaacgccggaagacctgatggcacgggat
gcctacctactcttctaccagcgccagaaccccgaccgtaaaaccggttccggttcgtcg
ctcggaacaacaacctccggccactggttctcccatgcaccacctctctcgtcgagccgg
agccacgagcagctcttggaacgttctcccgttcgacggcgggaaaccggttcgtctccg
gttcgtgctggtacgcctcctgctcttccccctcctccgaccagctactcggttctgccg
ggcggctgctccccttcggccggcgacgggagtcccggttcgccagccgcaccagttcgc
accaattcgttgagccgtggggagccccaggataccaccccacgagcctctggacccggt
ttgcaagtctccggtttgcaagtctccggtttgcaagtttccgggttacaagctcccagc
ttgaggacctccagtatgcgaaatggcgtcatgcgggacggagtcatgcgggacggagtc
gtgcgaaatggcgtcatgcgaaatggcgtcatgcgggatggtatcatgcgggacatcact
gtgcgagatgccagtctgttgcctaacatgtctcaagacaagccaactgttgagcagtgt
tcccctggggacgcaggagctgaggcacagcagcccacccacaaggaagctttctggact
gtgacttctgtgtga

DBGET integrated database retrieval system