KEGG   Ixodes scapularis (black-legged tick): IscW_ISCW005620Help
Entry
IscW_ISCW005620   CDS       T01131                                 

Definition
LAMMER dual specificity kinase, putative (EC:2.7.12.1)
Orthology
K08823  
CDC-like kinase [EC:2.7.12.1]
Organism
isc  Ixodes scapularis (black-legged tick)
Brite
Enzymes [BR:isc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     IscW_ISCW005620
Protein kinases [BR:isc01001]
 Serine/threonine protein kinases: CMGC group
  CLK family
   IscW_ISCW005620
Spliceosome [BR:isc03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    IscW_ISCW005620
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 382 aa AA seqDB search
GAEQSPVRRPPSVEDDEEGHLVYRPGDVLQDRYKIVTTLGEGTFGKVVKVTDMHTDQTMA
LKIIKNVEKYREAAKLEINVLEKLANWDPTGKHLCVKMLDWFDFHGHMCLAFEMLGLSVF
DFLKDNHYQPYPIDQVRHIGYQLCYSVMFLHEKQLTHTDLKPENILFVNSDYDISYNAKK
ASATAFAKRDIRRVKDTRIKLIDFGSATFDEEHHSTIVSTRHYRAPEVILELGWSQSCDV
WSVGCILFELCLGVTLFQTHDNREHLAMMERILGPLPYRMCRKTKTKYFYHGHLDWDEKS
SAGRYVKDNCKPLRRYMALDDEDSRQLFDLISRMLEYEPSQRISLLEALDHPFFASLPEE
YKLHVQLQRQGSACSREHSLSR
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
ggggcggagcagtctccagtgcggaggccaccaagcgtcgaggatgacgaagagggacac
ctggtgtaccggccaggagacgtgctccaggacagatacaagattgtcaccaccctggga
gaggggacctttgggaaggtggtcaaggtgaccgacatgcacactgaccagacgatggca
ctgaagatcataaagaatgtggagaagtaccgtgaagccgccaagctggagatcaatgtc
ctcgagaagcttgccaattgggaccccacgggcaaacatctctgtgtgaagatgttggat
tggtttgactttcacggccacatgtgtctcgccttcgaaatgctgggcctgagcgtcttc
gacttcttgaaggacaatcactaccagccataccccatcgatcaagtgcgtcacattgga
taccagctctgctactccgtcatgttcttgcacgagaagcagctgacccacactgacctg
aagcccgagaacatcttgtttgtcaactcggattatgacatcagctacaatgccaagaag
gcaagtgccacagcctttgcgaagcgggacatccggcgtgtgaaggacacgcgcatcaag
ctgatcgactttgggtcggccaccttcgacgaggagcaccactccacgattgtgtcaacg
cggcactaccgggcccctgaggtgatcctggagctgggctggagccagagctgcgacgtg
tggagcgtgggatgcatcctcttcgagctctgcctcggggtcaccctgttccagacccac
gacaaccgggagcacctggccatgatggagcgcatcctggggccactgccctaccgcatg
tgccgcaagaccaagacgaagtacttctaccacggccaccttgactgggacgagaagagt
tctgcgggccgctacgtcaaggacaactgcaaacctctacggcggtacatggccctggac
gacgaggacagccggcagctgttcgacctgatctctcggatgctggagtacgagccgtct
cagcgcatcagcctgctggaggcgctggaccacccgttctttgcctccctccccgaagag
tacaagctgcacgtgcagctgcagaggcagggttcagcctgctccagagagcacagcctg
agcaggtga

DBGET integrated database retrieval system