KEGG   Ixodes scapularis (black-legged tick): IscW_ISCW005703Help
Entry
IscW_ISCW005703   CDS       T01131                                 

Definition
norepinephrine/norepinephrine transporter, putative
Orthology
K05035  
solute carrier family 6 (neurotransmitter transporter, noradrenalin) member 2
Organism
isc  Ixodes scapularis (black-legged tick)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 702 aa AA seqDB search
MPTNNSSLVPKSEQLQQQQEQRNSAAGQPLIPAAGSVTEEYQESLEGGSKTSSPLPDSDK
RGPAFRPLVHQPQSKESPLIFEKSKLKRLRHSAIRDDGYCSSSSTPLSSEYVDHLGSTEG
QTEVILADGVASTVPIVVDAKAADSKGGSVVPSGPHDSGDRPTWKNKADFLLSIIGFAVD
LANVWRFPYLCYRNGGGVFLIPYLLMLVFGALPLFYMELVLGQYNRQGPISVWKLCPLFK
GVGYCSVLVSWYVSFYYNVIIGWALYFMFSSFRAELPWARCGNPWNTPSCYSGTLDDNGT
VQDDSMPIENRTSPALEFFNRAVLELHTSPGMHDLGVPKWQLLLCVMLVFVILYLALFKG
VSSSGKVVWVTATAPYVILTLLLLRGVLLPGAGTGVKYYLQPNVDKLLETQVWVDAAVQV
FYSVGVGFGVHLTYASYNPFHNNCYRDCLMTTAVNSFTSFYSGFVIFVYLGYMAAKQGVP
IQTVATEGHGLVFQVYPEAIATLPGAPIWAVLFFIMLLTLGLDSAMGGLESVITGLMDEF
KPFFSRWRCRREVFTAVVICASFCVSIVNVTRGGGYMITWFDTYSAGISLLCSALFESIG
IAWFYGLDRFCGNINEMLGFRPGIFWRLCWKFITPTFLVAVILSGIVNQAPVEYHNYRYP
TWAINMGWGLALSSVAMVPIVAAFKLCRAKGTCAELSHWTYV
NT seq 2109 nt NT seq  +upstreamnt  +downstreamnt
atgccaaccaacaattctagtttggttcccaaatcggagcagttacagcagcaacaggag
cagaggaactcggcggccggtcagcccctgatcccggcagccggttcggtcaccgaagaa
taccaagagtcccttgaaggaggttccaagacatcgagccccctgccggactccgacaag
cggggtcctgccttcaggcccctagtccatcagccgcagtccaaggagagtccgctcatc
ttcgagaagagcaagctcaagagactcaggcattcggccatacgagacgacggctattgt
tcttcttccagcacacccctctcttccgagtacgtggatcacctaggcagcaccgagggt
caaacggaagtgatcctggctgacggggtggcgtctacggtccccatcgtggtggacgct
aaggccgcggacagcaagggtggctccgtcgttccttcgggtcctcacgactccggagac
cgccccacgtggaagaacaaggcagacttcctcctctccatcatcgggttcgcggtagac
ctggctaacgtctggaggtttccttacctctgctatcggaatggtggaggggtgttcctg
ataccgtacctactgatgcttgttttcggagctttgccgctcttctacatggagctggtg
ctgggccagtacaacagacagggccccatcagtgtctggaagctgtgcccactctttaaa
ggtgtgggttactgctcggtgctggtgtcgtggtacgtgtccttctactacaacgtgatc
atcggctgggcgctgtacttcatgttctcctccttccgagccgagctgccatgggcccgg
tgcggcaatccctggaacacgcccagctgctatagcggcaccctggacgacaatggcaca
gtccaggatgactcgatgcccatcgaaaaccgcacctcccccgctctcgagtttttcaat
cgggcggtgctggagctgcacacgagtcctggcatgcacgatctgggcgtccccaagtgg
cagctgctcctctgcgtcatgctcgtcttcgtcatcctctacctggcgctgttcaaaggt
gtcagctcctccggcaaagtggtgtgggtgacggcgacggctccttacgtcattctgacc
ctgctcctgctccgaggggtactgcttcctggcgccggtacgggggttaagtactacctc
cagcccaacgtggacaagctgctggaaacccaggtgtgggtggacgctgctgtgcaggtt
ttctactcggtaggagtcgggtttggcgtgcacctgacgtatgcctcctacaacccgttc
cacaacaactgctacagggactgcctgatgacgacggcggtgaacagcttcacgagcttc
tacagcggcttcgtgatcttcgtgtacctgggctacatggcggccaagcagggcgtgccc
atccagacggtggccaccgagggccacggcctggttttccaggtgtacccggaggccatc
gccaccctgcccggggctcccatctgggccgtcctcttcttcatcatgctcctcaccctg
ggcctggacagcgccatgggcggtctggagagcgtcatcacgggtctgatggacgagttc
aagccctttttctcccggtggcggtgtcggcgagaggtcttcacggccgtcgtcatctgc
gcctccttctgcgtgtccatcgtgaacgtcaccaggggcggaggctacatgataacctgg
ttcgacacctattcggccggcatctccctgctctgctcggcgctttttgagtctattggc
atcgcctggttttacggcttggaccgattctgcggcaacatcaacgagatgctgggcttc
cgccccgggatcttctggcggctttgctggaagtttatcactccgacttttcttgtggcg
gtgatcctgagcggcatcgttaaccaggcgcccgtggagtaccacaactaccggtaccca
acgtgggccatcaacatgggctggggcctggccctgtcctcggtcgccatggtgcccatc
gtggccgctttcaagctgtgccgggccaagggcacctgcgccgagctgagccactggacc
tatgtgtaa

DBGET integrated database retrieval system