KEGG   Ixodes scapularis (black-legged tick): IscW_ISCW006011Help
Entry
IscW_ISCW006011   CDS       T01131                                 

Definition
ras GTP exchange factor, son of sevenless, putative
Orthology
K03099  
son of sevenless
Organism
isc  Ixodes scapularis (black-legged tick)
Pathway
FoxO signaling pathway
Dorso-ventral axis formation
Jak-STAT signaling pathway
Class
Environmental Information Processing; Signal transduction; Jak-STAT signaling pathway [PATH:isc04630]
Environmental Information Processing; Signal transduction; FoxO signaling pathway [PATH:isc04068]
Organismal Systems; Development; Dorso-ventral axis formation [PATH:isc04320]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 1034 aa AA seqDB search
EVDSQEIASKWKGLLVAALKKVQCQVHPTLTATDDALEYVESLVLRLLGTLCLGRPHSVQ
DVEERVVRLFPHPIDQWAIRDAQAALERGRRRSSLVLPLDKVHPLLQKVLGYRLDLQVSQ
YMVAVLEYIAADILKLTGNYVKNIRHAEITCQDCRVAMCADKVLMDMFHGEELATAEEES
PGGRPPMSYDEEVKDLISEERQHIRELNMVIKVFREPLDKLFPGSKVPFSPSDLDVIFGN
VSEVYDFSVSLLGSFEDVVEMTDEHQSPAIGSCFYEMAEYDEFDVYEDYARTVLSPDCRE
KLSQLLQQPDVANSLQTAGHGFLLAVKYVLPRLLWGPVAHCFQYFEAIKVLQQMAPSEED
RETLEQAEGLLRRLRTQLTRTCSDTLPRKRPGDVSLRMHSRDRRAVALHKLKELQKSVDG
WEGRDIGQCCNEYLMEGSLGKVGSGRRLTERHLFLFDGLVLLCKHSSKRSSVTGGPTPEF
RLKECFFLRRIEIVDREDTDEIKHSFEIAPRDAPRILLYAKNAEEKCSWMANLVMLNMRS
MLERTLDSILSDEEKKHPLRLPDNYRFSLEDSEDHVVFEESKTNAGVPLIKGATLLKLVE
RLTYHMYADPMFVRTFLTTFRSFCQPHELLDLLAERYPFLPDQAEGAEAEAARNLHRECL
KRFRKEYSQPVQFRVLNVLRHWVDHHYYDFERDASLLEKLRGFLDRVKGKNMRKWVESIN
KVVQRRSEQQDEPREITFSYEKSPPHIEWFLCSTPDKFDILTLHPIEIARQLTLLEFDLY
RAVKPSELVNAAWTKKDKHKTSPNLLKMIHHSSNFSFWLERCIVETDNFEERVAVVSRML
EVMLVLQELNNFTGVFAVSSAMSSACVHRLEHTSGAIKCNLKKALDEAFDLQSDHCRKYQ
EKLRSINPPCVPFLGMYLTNILHIEEGNLDFLPNHEGLINFSKRRKVAEITGEIQQYQNQ
PYCLTSQADIRQFLESLNPQESLTEKEFNDYLYAKSLEIEPRGCRQPPKFPRKWPDLPLK
SPGIKPRLTRSGGS
NT seq 3102 nt NT seq  +upstreamnt  +downstreamnt
gaagtggacagccaagagattgcgtccaagtggaagggactactcgtcgcggcgctcaag
aaggtccagtgccaggtgcacccgaccctgacagccacggacgacgcactggagtatgtg
gagtccctggtgctgcgattgctgggtaccctgtgcctggggcgcccccactcggtgcag
gacgtggaggagcgggtggtgcgcctgttcccccaccccatcgaccagtgggccatccgg
gacgcccaggctgccctcgagaggggccgccggaggtcctctctagtgctgcccctcgac
aaggtgcatccactcctccagaaggtgcttggctaccggctggacctgcaagtgagccag
tacatggtggcggtgctggagtacattgcggctgacattctcaagctaacgggcaactat
gtcaagaacatccggcacgcggagatcacctgccaggactgccgcgtggccatgtgtgcc
gacaaggtgctcatggacatgtttcacggggaggagctcgcaacggcggaagaggagtcc
cccggcggccgtcccccgatgtcctacgacgaggaggtgaaggacctcatctcggaggag
cggcagcacatccgggaactcaacatggtcatcaaggtctttcgggaaccactcgacaag
ctctttccaggaagcaaggtgcccttcagcccctctgatctggacgtgatctttggaaac
gtgtcggaggtgtacgacttcagcgtctccctgctcggttctttcgaggacgtcgtggag
atgacggacgaacaccagagccctgccatcggctcctgcttctacgagatggccgagtac
gacgaattcgacgtctacgaggactacgcccggacggtgctttcgccagactgccgggaa
aagttgtctcagttgctacagcagcccgacgtggccaactcccttcagacggctggacac
ggttttctgctggcggtgaagtatgtcctgccgcggctgctctggggccctgttgcccat
tgtttccagtatttcgaagccatcaaggtcctgcaacagatggctccgtcggaagaggac
cgggagacgctggagcaggcagagggactgctccggaggctccgaacccagctgacgcgc
acctgctccgacaccctgccccgcaaaaggcccggggacgtttccctacggatgcacagc
cgggaccgccgtgcggtggccctgcacaagctcaaggagctccagaagtccgtggacggt
tgggagggccgggacatcggccagtgctgcaacgagtacctgatggagggctccctgggg
aaggtggggtcggggcggcggctgacggagcggcacctgttcctcttcgacggcctggtg
ctcctgtgcaagcacagcagcaagcggtccagcgtcacgggcggtccgacgcccgagttc
cggctcaaggagtgcttcttcctcagacggatagagatcgtcgacagggaggacactgat
gaaatcaagcattcctttgagatagcgccgagagacgcaccacggatcctcctgtatgcc
aagaatgccgaggaaaagtgcagctggatggcgaacctggtcatgctgaatatgcgcagc
atgctggaacgcaccctggacagcattctgtcagatgaagagaagaaacatcctcttcgc
cttcctgacaactacaggttctccctggaggactcggaggaccatgtggtgtttgaggag
agcaagaccaatgccggggtgcccctgatcaagggagccacgctgctgaagctggtggag
cggctcacgtaccacatgtacgcggaccccatgtttgtgcggacattcctcaccaccttc
cgctccttctgccagccccacgagctcctggacctcctcgccgagagatatcctttcctg
cccgaccaggcggagggtgccgaggcggaagcggcgcgcaacctccaccgagagtgtctc
aagcgcttccgcaaggagtacagccagcctgtccagttcagggtgctgaacgtgctgcgc
cactgggtggaccaccactactacgacttcgagagggacgccagcctgctggagaagctg
cggggcttcctggaccgggtcaagggcaagaacatgcgcaagtgggtcgagtccatcaac
aaggtcgtccagaggaggagcgagcagcaagacgagcctcgggagatcacattcagctac
gaaaagagtccgccccacatagaatggttcctgtgcagcactccagacaagttcgacatt
ctcactctgcaccccatcgagatcgcccggcagctgacccttctggagttcgacctgtac
cgggcagtcaagccttcggagcttgtcaacgctgcctggaccaagaaggacaagcacaag
acctcccccaacctgctcaagatgatccaccactcgtccaatttctcattctggctggag
cggtgcatagtggagacggacaactttgaggagcgcgtggcggtggtgtctcggatgctg
gaggtgatgcttgtcctccaggagctgaacaacttcacgggcgtctttgcagtctccagc
gccatgtccagcgcctgtgtccaccggctggagcacacgtcgggcgccatcaagtgcaat
ctgaagaaggcgctggacgaggccttcgacctccagtcggaccactgccggaagtaccag
gagaagctgcgctccatcaacccgccctgcgtgccgttcctgggcatgtacctgaccaac
atcttgcacatcgaggagggcaacctggacttcctgcccaaccacgagggcctcatcaac
ttcagcaagcgccgcaaggtggccgagatcaccggggagatccagcagtaccagaaccag
ccctactgcctcaccagccaggcggacatacggcaattcctggagagcctgaacccccag
gagagcttgacggagaaggagttcaacgactacctgtacgccaagtccctggagatcgaa
ccccggggctgccggcagccacccaaattcccccgcaagtggccagacctcccgctcaag
tcgcccgggatcaagccgaggctgacgcggtcagggggcagc

DBGET integrated database retrieval system