KEGG   Ixodes scapularis (black-legged tick): IscW_ISCW006138Help
Entry
IscW_ISCW006138   CDS       T01131                                 

Definition
(RefSeq) initiation factor 4E, putative
  KO
K03259  translation initiation factor 4E
Organism
isc  Ixodes scapularis (black-legged tick)
Pathway
isc03013  RNA transport
isc04150  mTOR signaling pathway
Module
isc_M00428  eIF4F complex
Brite
KEGG Orthology (KO) [BR:isc00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    IscW_ISCW006138
 Environmental Information Processing
  Signal transduction
   04150 mTOR signaling pathway
    IscW_ISCW006138
Messenger RNA biogenesis [BR:isc03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     IscW_ISCW006138
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     IscW_ISCW006138
Translation factors [BR:isc03012]
 Eukaryotic Type
  Initiation factors
   eIF-4
    IscW_ISCW006138
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IF4E
Motif
Other DBs
NCBI-GeneID: 8051457
NCBI-ProteinID: XP_002435088
VectorBase: ISCW006138
UniProt: B7PMU0
AA seq 219 aa AA seqDB search
MRLAQDESQGDDGEAVVGQQRQIMAAPLTGTPEERGEHRLQFAYSLWFSRRAPGKQPNNQ
RYDQNLKLVCTFDTVEQFWRNYSHLMRPSELSGHSDYHLFKEGIKPMWEDDANRTGGKWI
VRLRKGLASRCWENLILAILGEQFMVGEEVCGAVVSIRFQEDIVSIWNRTASDSQTTIRI
RDTLRRVLNLPINTVMEYKTHTDSLRDNSSFRNTDIFLR
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
atgaggctggcccaagacgagtcgcagggggacgacggggaggcggtggtgggccagcag
agacaaatcatggctgctccgctgaccggcacccccgaggagcgcggggagcaccgtctc
cagtttgcctactccctgtggttctcacggagggcaccgggcaagcagcccaacaaccag
cgctacgaccagaacctcaagctggtctgcacctttgacaccgttgaacagttctggagg
aactacagccacctcatgcgaccctcggagttgtctggacacagcgactaccatctcttc
aaggagggcatcaaaccgatgtgggaggacgatgcaaaccgcacggggggcaagtggatc
gtgcgtctgcgcaagggcctggcctcccgctgttgggaaaacctgatcctggccatcctg
ggcgagcagttcatggttggcgaggaagtgtgcggtgcggtggtatccatccgcttccag
gaggacatagtgtccatctggaaccggacagccagtgactcccagaccaccatccgcatt
cgggacaccctccgcagggtcctcaacctacccatcaacactgttatggagtacaagacc
cacaccgacagcctgagggataattccagtttccggaacactgacatcttcctcagatga

DBGET integrated database retrieval system