KEGG   Ixodes scapularis (black-legged tick): IscW_ISCW006138Help
Entry
IscW_ISCW006138   CDS       T01131                                 

Definition
initiation factor 4E, putative
Orthology
K03259  
translation initiation factor 4E
Organism
isc  Ixodes scapularis (black-legged tick)
Pathway
RNA transport
mTOR signaling pathway
Module
eIF4F complex
Brite
KEGG Orthology (KO) [BR:isc00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    IscW_ISCW006138
 Environmental Information Processing
  Signal transduction
   04150 mTOR signaling pathway
    IscW_ISCW006138
Translation factors [BR:isc03012]
 Eukaryotic Type
  Initiation factors
   eIF-4
    IscW_ISCW006138
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 219 aa AA seqDB search
MRLAQDESQGDDGEAVVGQQRQIMAAPLTGTPEERGEHRLQFAYSLWFSRRAPGKQPNNQ
RYDQNLKLVCTFDTVEQFWRNYSHLMRPSELSGHSDYHLFKEGIKPMWEDDANRTGGKWI
VRLRKGLASRCWENLILAILGEQFMVGEEVCGAVVSIRFQEDIVSIWNRTASDSQTTIRI
RDTLRRVLNLPINTVMEYKTHTDSLRDNSSFRNTDIFLR
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
atgaggctggcccaagacgagtcgcagggggacgacggggaggcggtggtgggccagcag
agacaaatcatggctgctccgctgaccggcacccccgaggagcgcggggagcaccgtctc
cagtttgcctactccctgtggttctcacggagggcaccgggcaagcagcccaacaaccag
cgctacgaccagaacctcaagctggtctgcacctttgacaccgttgaacagttctggagg
aactacagccacctcatgcgaccctcggagttgtctggacacagcgactaccatctcttc
aaggagggcatcaaaccgatgtgggaggacgatgcaaaccgcacggggggcaagtggatc
gtgcgtctgcgcaagggcctggcctcccgctgttgggaaaacctgatcctggccatcctg
ggcgagcagttcatggttggcgaggaagtgtgcggtgcggtggtatccatccgcttccag
gaggacatagtgtccatctggaaccggacagccagtgactcccagaccaccatccgcatt
cgggacaccctccgcagggtcctcaacctacccatcaacactgttatggagtacaagacc
cacaccgacagcctgagggataattccagtttccggaacactgacatcttcctcagatga

DBGET integrated database retrieval system