KEGG   Ixodes scapularis (black-legged tick): IscW_ISCW006623Help
Entry
IscW_ISCW006623   CDS       T01131                                 

Definition
thrombospondin, putative
Orthology
K04659  
thrombospondin 2/3/4/5
Organism
isc  Ixodes scapularis (black-legged tick)
Pathway
Phagosome
ECM-receptor interaction
Class
Environmental Information Processing; Signaling molecules and interaction; ECM-receptor interaction [PATH:isc04512]
Cellular Processes; Transport and catabolism; Phagosome [PATH:isc04145]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 789 aa AA seqDB search
LPDVAAATPSEPPQRDVNSRGYGGEDLNDNRLATRALIDLLELLQESKKAVEVQTRALLM
LTEVLSRCQFCRSRGDDDDVINIGVAAVQCSEKPCFRGVSCRDTRSGFQCGPCPPGYAGD
GGNGSHCEDVDECDAANPCHPHVACINESPGFRCGPCPRGFEGGELRGVGLEFARRARQH
CHDLDECADGRNGGCVPHSRCTNTPGSRVCGECLEGFMGNQTAGCHPRPGTCPDGSLCDG
NADCLPRRGSGTYACRCRVGWAGDGRLCGTDRDLDGWPDASLPCGHRRCRADNCPGTPNS
GQEDADDDGTGDACDEDADDDGVLNSPDNCPLVANPGQEDTDPDGPDHLGDACDNCPTVP
NPDQVDSDGDGLGDLCDPDADDDGVLNERDNCPTTPNADQRDSDGDGLGDACDNCPRAKN
PDQIDSDRDLVGDACDDNIDRDRDGIQDSWDNCPDDANSDQLDTDEDGRGDACDFDKDND
GVPDSADNCALVYNPDQRDTNRTGVGDACKEDFDGDSIPDPLDVCPDNRRVYATDFRAYQ
TVVLDPEGDSQIDPHWVVYNKGAEIVQTMNSDPGLAVGYQKFGGVDFEGTFFVDTEVDDD
YVGFVFGYQDNGRFYAVMWKKSSQTYWQATPFRAVAEPGIQLKLVNSDTGPGETLRNALW
HTGDTHGQVRLLWRDPRNVGWKEKVAYRWLLLHRPALGLVRLRVFEGDQLVADSGNVYDS
TLQGGRLGVFCFSQEAIIWSDLVYRCNEALPETAYRDLPRELRAKARRDNVTPSELPLTP
VPSVNNNLV
NT seq 2370 nt NT seq  +upstreamnt  +downstreamnt
cttccagacgttgcggcagcgacgccctctgaaccaccacagcgggacgtcaactccaga
ggctacggcggagaggacctcaacgacaaccgcctcgccacgcgggccttgatcgacctc
ctggaacttttgcaagagtccaagaaggctgttgaagtccagacgcgagcgctgctgatg
ctcaccgaagtcctgtcccgatgtcagttctgccgttcgcgaggcgacgatgacgacgtc
atcaacatcggcgtcgcggctgtccagtgctcggagaagccatgcttccgaggagtgtcg
tgtcgcgacaccaggtccggattccagtgtggcccgtgtcctcctggttacgcgggcgat
ggaggcaacggttcccactgcgaggacgtggacgagtgcgacgcggccaacccgtgccac
ccgcacgtggcttgcatcaacgagtcacccggtttccgctgcgggccctgcccccggggc
ttcgagggcggagagctgcgcggggtgggcctggagttcgcgcgcagggccagacagcac
tgccacgacctggacgagtgcgccgacggaaggaacggcggctgcgtcccgcactcgcgc
tgcaccaacacgccgggctccagggtgtgcggcgagtgcctggaaggctttatgggcaac
cagacggcgggctgccacccgcggccgggcacctgcccggacggctcgctgtgcgacggc
aacgccgactgcctgcccaggaggggctcgggcacgtacgcctgccgctgccgcgtcggc
tgggccggagacggacgcctgtgcggcaccgacagggacctcgacggatggcccgacgcg
tcgctgccctgtggacaccggcgctgccgtgccgacaactgcccgggcacgcccaactcg
ggccaggaggacgcggacgacgacggcacgggcgacgcgtgcgacgaagacgccgacgac
gacggggtgctcaacagcccggacaactgcccgctcgtcgccaacccgggccaggaggac
accgacccggacggaccggaccacctgggcgacgcctgcgacaactgccccaccgtgccg
aacccggaccaggtcgactctgacggcgacggcctgggcgacctgtgcgacccggacgcc
gacgacgacggcgttctcaacgagagggacaactgcccgacgacgcccaacgcggaccag
cgcgacagcgacggcgacggtctcggagacgcgtgcgacaactgcccgcgcgccaagaac
cccgatcagatcgactccgacagggatctcgtgggagacgcctgcgacgacaacatcgac
agggaccgcgacggcatacaggactcgtgggacaactgcccggacgacgccaactcggac
cagctggacacggacgaggacggccggggcgatgcgtgcgacttcgacaaggacaacgac
ggcgtgccggactcggcggacaactgcgccctcgtgtacaacccggaccagcgggacacc
aaccggacgggcgtcggagacgcctgcaaggaggacttcgacggagactccatcccagat
ccgctggacgtctgcccggacaacaggcgcgtctacgccacggacttcagggcgtaccaa
acagtggtgctggatcccgaaggagactcccagatagatccccactgggtggtctacaac
aagggcgccgagatagtgcaaaccatgaactcagaccccggactcgcggtcggataccaa
aaattcggaggagtcgatttcgaaggtaccttcttcgtggacaccgaagtggacgacgac
tacgtgggcttcgtgttcggctaccaggacaacggccgcttctacgccgtcatgtggaag
aagagcagccagacgtactggcaggccacgccgttcagggccgtcgcggagcctggcatc
cagctcaaactcgtcaattcggacaccgggccaggggagacgctccgcaacgcgctctgg
cacacgggagacacgcacggccaggtgcgcctgctgtggcgcgacccccgcaacgtgggc
tggaaggagaaagtggcctaccgctggctcctgctgcaccgacccgccctgggactcgtg
cgcctgcgcgtcttcgaaggggaccagctggtcgccgactccggcaacgtgtacgactcg
acgctgcaagggggacgtctcggagtgttctgcttctcccaggaggccatcatctggtcc
gacctggtctaccggtgcaacgaggccctcccggagaccgcctacagagacctgccccgg
gagctgagggccaaggcgcggagggacaacgtcaccccgtccgagctgccgctcacgccc
gtgccgtccgtcaacaacaacctcgtctga

DBGET integrated database retrieval system