KEGG   Ixodes scapularis (black-legged tick): IscW_ISCW006671Help
Entry
IscW_ISCW006671   CDS       T01131                                 

Definition
hypothetical protein
Orthology
K01792  
glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
isc  Ixodes scapularis (black-legged tick)
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:isc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    IscW_ISCW006671
Enzymes [BR:isc01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.15  glucose-6-phosphate 1-epimerase
     IscW_ISCW006671
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 150 aa AA seqDB search
MDLEGGAHTLANGDTTAVFILSDVEQTRAIWDFRFQLIYRVTLRNNQLVLEVEVVNTDEK
EFEFTLLLHTYLKTDDIQLCSISNLKGCSYIDKVDGNKEKTETAELVYIKKATDRVYKKT
GEKHSCKLNGSTVNIIKKNFPDTGNYLPIT
NT seq 453 nt NT seq  +upstreamnt  +downstreamnt
atggaccttgaaggaggcgcacacactttggcaaacggagacactacagccgtctttatc
ctgtcagatgttgagcaaaccagggctatctgggatttcaggttccagctgatttatcgg
gtgaccttgaggaacaaccaacttgtccttgaggttgaggtggtgaacacagatgaaaag
gagtttgagttcactctgcttctgcatacctacctgaagacagacgacatccagctttgc
tccatctcgaacctgaaaggctgctcttacatcgataaggtagatggaaataaggaaaag
actgaaactgccgaattggtctacatcaagaaagctactgacagagtgtataagaagacc
ggtgaaaagcactcctgcaagctgaacggctccactgtgaatattataaaaaagaacttt
ccggacaccggtaattacctacctattacctaa

DBGET integrated database retrieval system