KEGG   Ixodes scapularis (black-legged tick): IscW_ISCW006884Help
Entry
IscW_ISCW006884   CDS       T01131                                 

Definition
beta-glucocerebrosidase, putative (EC:3.2.1.45)
Orthology
K01201  
glucosylceramidase [EC:3.2.1.45]
Organism
isc  Ixodes scapularis (black-legged tick)
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Lysosome
Class
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:isc00600]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:isc00511]
Cellular Processes; Transport and catabolism; Lysosome [PATH:isc04142]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 525 aa AA seqDB search
MARVVAALLLCVLGQRIESVCIHRNFGKGSTVCVCDSVQCDMLGRIPKLAAGVAAVYESS
KDGSRFLSTTIEFVPHDSNRTALSSTTSRTRSVIKIKQENKFQHIFGFGGSFTDSAGINI
LSLREPLRGKLLESYFSEEGLDYNMGRVPIASSDFSTRVYSYADVANDFKLLKFSLAPED
MRLKIPLIQEAQKLKTTDQLWLIASPWSAPAWMKTNSAMSGRGTLRGQPNGIYYKTWAQY
LVKFLNAYRDRNVTFWGITAQNEPSSGFIPFYSFQTMGFSASSQRDFVKFDLGPALERAD
YGPNKLKLMILDDQRIFLPNFANVVLQDPEASKYVAGIAFHWYWNHMKGPQALDETHASH
PDKFLLATEACEGATSLLRNRVILGSWSRAASYAYDIIHDMRHWTTGWIDWNLALNTRGG
PNWARNFVDSPIIVNATAGEFYKQPMYYALAHFTKFVSRGSKRVDCGSQRRLETVAFVRP
DNATVLVVMNRRSIERSFTVVDSQLGSLNFSIPGHAIQTYIWWSQ
NT seq 1578 nt NT seq  +upstreamnt  +downstreamnt
atggcccgagttgtcgcggcgctcttgctgtgtgtgttaggccagcgcatcgaaagcgtc
tgcatccacaggaacttcggaaaaggcagcacggtttgcgtctgcgacagcgtgcagtgc
gacatgctggggcggataccgaagcttgccgccggcgtcgcagctgtctacgaaagcagc
aaggatgggtcgaggtttctgtcaacgaccattgagtttgttccgcacgatagcaaccgt
actgcgctctcctcaacgacatcgaggactcgcagcgttatcaagattaagcaagaaaac
aagttccaacacatattcggatttggtggttcttttacggattccgctggtatcaacatc
ctcagcctgcgcgaacctctacgaggtaagcttctcgagtcatatttttccgaggaaggt
ctcgattacaacatgggaagagtgcccattgcaagctcggacttctccactcgtgtgtat
tcctacgccgacgttgcaaacgacttcaaacttctcaaattcagccttgcccccgaggac
atgaggctcaagatcccactgattcaggaagcgcaaaagctaaagacgaccgaccagctg
tggctcatcgccagcccctggagtgccccagcttggatgaagacgaacagtgccatgagt
ggacgaggaactttacggggccagccgaatggcatctactacaagacctgggcacaatac
ttggtcaagttcctcaatgcctaccgcgaccgcaacgtcaccttctggggtatcacagct
cagaatgagccatcgtctggtttcattccattctactctttccagacaatgggcttcagt
gccagctcccagcgagactttgtaaaatttgatctcggccctgctctcgagagggcggac
tatggacccaacaaactcaagctgatgatcctggacgaccagaggatctttctgccaaac
tttgccaatgttgtgctgcaggaccccgaagcctccaagtatgtggcgggcattgccttc
cactggtactggaatcacatgaagggacctcaggccttggacgagacccacgcttcacac
cctgacaagtttctcctggcaacggaagcatgcgaaggtgctacgtcgctcttgaggaac
agggtcattcttgggagttggagccgggctgccagctacgcatatgacatcattcacgac
atgcgccactggacgacgggctggatcgattggaacctggcgctgaacacaagagggggt
cccaactgggcacgcaattttgttgattccccgatcattgtgaacgccacggccggagag
ttctacaagcagcctatgtattatgcccttgcccacttcaccaaatttgtgtcccgtggc
tcgaagcgggtggactgcggctcccagcggcgactggaaactgtggcttttgtcagaccg
gacaatgcgacggtcttggtggtgatgaacaggcgttccatcgaacggtctttcactgtg
gttgattcacagcttggaagcttgaacttcagcattcctggtcatgcgattcaaacttac
atttggtggtcacaatag

DBGET integrated database retrieval system