KEGG   Ixodes scapularis (black-legged tick): IscW_ISCW006884Help
Entry
IscW_ISCW006884   CDS       T01131                                 

Definition
beta-glucocerebrosidase, putative (EC:3.2.1.45)
Orthology
K01201  
glucosylceramidase [EC:3.2.1.45]
Organism
isc  Ixodes scapularis (black-legged tick)
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Lysosome
Brite
KEGG Orthology (KO) [BR:isc00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    IscW_ISCW006884
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    IscW_ISCW006884
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    IscW_ISCW006884
Enzymes [BR:isc01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     IscW_ISCW006884
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 525 aa AA seqDB search
MARVVAALLLCVLGQRIESVCIHRNFGKGSTVCVCDSVQCDMLGRIPKLAAGVAAVYESS
KDGSRFLSTTIEFVPHDSNRTALSSTTSRTRSVIKIKQENKFQHIFGFGGSFTDSAGINI
LSLREPLRGKLLESYFSEEGLDYNMGRVPIASSDFSTRVYSYADVANDFKLLKFSLAPED
MRLKIPLIQEAQKLKTTDQLWLIASPWSAPAWMKTNSAMSGRGTLRGQPNGIYYKTWAQY
LVKFLNAYRDRNVTFWGITAQNEPSSGFIPFYSFQTMGFSASSQRDFVKFDLGPALERAD
YGPNKLKLMILDDQRIFLPNFANVVLQDPEASKYVAGIAFHWYWNHMKGPQALDETHASH
PDKFLLATEACEGATSLLRNRVILGSWSRAASYAYDIIHDMRHWTTGWIDWNLALNTRGG
PNWARNFVDSPIIVNATAGEFYKQPMYYALAHFTKFVSRGSKRVDCGSQRRLETVAFVRP
DNATVLVVMNRRSIERSFTVVDSQLGSLNFSIPGHAIQTYIWWSQ
NT seq 1578 nt NT seq  +upstreamnt  +downstreamnt
atggcccgagttgtcgcggcgctcttgctgtgtgtgttaggccagcgcatcgaaagcgtc
tgcatccacaggaacttcggaaaaggcagcacggtttgcgtctgcgacagcgtgcagtgc
gacatgctggggcggataccgaagcttgccgccggcgtcgcagctgtctacgaaagcagc
aaggatgggtcgaggtttctgtcaacgaccattgagtttgttccgcacgatagcaaccgt
actgcgctctcctcaacgacatcgaggactcgcagcgttatcaagattaagcaagaaaac
aagttccaacacatattcggatttggtggttcttttacggattccgctggtatcaacatc
ctcagcctgcgcgaacctctacgaggtaagcttctcgagtcatatttttccgaggaaggt
ctcgattacaacatgggaagagtgcccattgcaagctcggacttctccactcgtgtgtat
tcctacgccgacgttgcaaacgacttcaaacttctcaaattcagccttgcccccgaggac
atgaggctcaagatcccactgattcaggaagcgcaaaagctaaagacgaccgaccagctg
tggctcatcgccagcccctggagtgccccagcttggatgaagacgaacagtgccatgagt
ggacgaggaactttacggggccagccgaatggcatctactacaagacctgggcacaatac
ttggtcaagttcctcaatgcctaccgcgaccgcaacgtcaccttctggggtatcacagct
cagaatgagccatcgtctggtttcattccattctactctttccagacaatgggcttcagt
gccagctcccagcgagactttgtaaaatttgatctcggccctgctctcgagagggcggac
tatggacccaacaaactcaagctgatgatcctggacgaccagaggatctttctgccaaac
tttgccaatgttgtgctgcaggaccccgaagcctccaagtatgtggcgggcattgccttc
cactggtactggaatcacatgaagggacctcaggccttggacgagacccacgcttcacac
cctgacaagtttctcctggcaacggaagcatgcgaaggtgctacgtcgctcttgaggaac
agggtcattcttgggagttggagccgggctgccagctacgcatatgacatcattcacgac
atgcgccactggacgacgggctggatcgattggaacctggcgctgaacacaagagggggt
cccaactgggcacgcaattttgttgattccccgatcattgtgaacgccacggccggagag
ttctacaagcagcctatgtattatgcccttgcccacttcaccaaatttgtgtcccgtggc
tcgaagcgggtggactgcggctcccagcggcgactggaaactgtggcttttgtcagaccg
gacaatgcgacggtcttggtggtgatgaacaggcgttccatcgaacggtctttcactgtg
gttgattcacagcttggaagcttgaacttcagcattcctggtcatgcgattcaaacttac
atttggtggtcacaatag

DBGET integrated database retrieval system