KEGG   Ixodes scapularis (black-legged tick): IscW_ISCW006910Help
Entry
IscW_ISCW006910   CDS       T01131                                 

Definition
mitogen-activated protein kinase kinase MKK4, putative (EC:2.7.12.2)
Orthology
K04431  
mitogen-activated protein kinase kinase 7 [EC:2.7.12.2]
Organism
isc  Ixodes scapularis (black-legged tick)
Pathway
Protein processing in endoplasmic reticulum
Class
Genetic Information Processing; Folding, sorting and degradation; Protein processing in endoplasmic reticulum [PATH:isc04141]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 364 aa AA seqDB search
MWNREALTLLQMASTVGASQLGPLSGEGCVGRVLQPGHVSSGRSGGAESERKLQEILQAG
NVLTIGGQRHRVKTEDLEQLGDLGCGTCGHVVKMRHRPTGKVLAVKQMRRSGNREENKRI
TMDLEVVLRCQDCPHIVQCLGYLMTEGEVWICMELMCTCLDKLLRRLRPRALPEDILGRT
ALGVLRALHYLKERHGLIHRDVKPSNVLLDRAGRVRLCDFGISGRLVDSKARTRSAGCAA
YMAPERIDPPDPTKPDYDIRADVWSLGISMVELATGQFPYKDCKTDFEVLSRVLQEKPPS
LPNDGSFSPEFCSFVKDCLTKDYRERPKYRELLEHPFIKRYETKEVDVAAWLAEVMDGSS
EDGL
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atgtggaaccgcgaggcactgacactacttcagatggccagcacagtgggtgcctcgcag
ttaggccccctttctggggagggctgtgtcgggcgagtgctacagcctgggcatgtgtcc
tccggtcgcagcgggggtgcagagtcggagcgcaagctgcaggagatcctgcaggcgggc
aacgtgctgacgataggcggccagcggcaccgggtaaagaccgaggacctggagcagttg
ggggacctggggtgcggcacgtgcggccacgtggtgaagatgcgccacaggcccacgggc
aaggtgctggcggtgaagcagatgaggcgctctggcaaccgggaggaaaacaagcgcatc
acgatggacctagaggtggtgctgcgctgccaggactgcccccacatcgtccagtgcctt
ggctacctgatgacggagggggaggtgtggatctgcatggagctgatgtgcacctgcctg
gacaagcttctgcggcggctgcggccccgggccctgcccgaggacatcctgggccgcacg
gccctgggggtgctgcgggccctgcactacctcaaggagcgccacggcctcatccaccgg
gacgtgaagccctccaacgtgctgctcgaccgggccggaagggtgcgcctgtgcgacttc
ggcatcagcggccgcctcgtcgactccaaggcccgcacgcggtcggccggctgcgccgcc
tacatggcccccgagcggatcgacccgccggacccgaccaagccggattacgacatccgg
gcggacgtctggagcctgggcatatccatggtggagctggccacgggccagttcccgtac
aaggactgcaagacggactttgaggtgctgagccgggtgctgcaggaaaagccccccagc
ctgccgaacgacgggtccttctcccccgagttctgctcctttgtcaaagactgtcttaca
aaggactacagggagaggcccaagtaccgggagctcctggagcacccgttcatcaagcgc
tacgaaacgaaggaggtggacgttgcggcctggctggcggaggtcatggacggctcttcc
gaggacggactgtga

DBGET integrated database retrieval system