KEGG   Ixodes scapularis (black-legged tick): IscW_ISCW006910Help
Entry
IscW_ISCW006910   CDS       T01131                                 

Definition
mitogen-activated protein kinase kinase MKK4, putative (EC:2.7.12.2)
Orthology
K04431  
mitogen-activated protein kinase kinase 7 [EC:2.7.12.2]
Organism
isc  Ixodes scapularis (black-legged tick)
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:isc00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    IscW_ISCW006910
Enzymes [BR:isc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     IscW_ISCW006910
Protein kinases [BR:isc01001]
 Serine/threonine protein kinases: STE group
  STE7 family
   IscW_ISCW006910
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 364 aa AA seqDB search
MWNREALTLLQMASTVGASQLGPLSGEGCVGRVLQPGHVSSGRSGGAESERKLQEILQAG
NVLTIGGQRHRVKTEDLEQLGDLGCGTCGHVVKMRHRPTGKVLAVKQMRRSGNREENKRI
TMDLEVVLRCQDCPHIVQCLGYLMTEGEVWICMELMCTCLDKLLRRLRPRALPEDILGRT
ALGVLRALHYLKERHGLIHRDVKPSNVLLDRAGRVRLCDFGISGRLVDSKARTRSAGCAA
YMAPERIDPPDPTKPDYDIRADVWSLGISMVELATGQFPYKDCKTDFEVLSRVLQEKPPS
LPNDGSFSPEFCSFVKDCLTKDYRERPKYRELLEHPFIKRYETKEVDVAAWLAEVMDGSS
EDGL
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atgtggaaccgcgaggcactgacactacttcagatggccagcacagtgggtgcctcgcag
ttaggccccctttctggggagggctgtgtcgggcgagtgctacagcctgggcatgtgtcc
tccggtcgcagcgggggtgcagagtcggagcgcaagctgcaggagatcctgcaggcgggc
aacgtgctgacgataggcggccagcggcaccgggtaaagaccgaggacctggagcagttg
ggggacctggggtgcggcacgtgcggccacgtggtgaagatgcgccacaggcccacgggc
aaggtgctggcggtgaagcagatgaggcgctctggcaaccgggaggaaaacaagcgcatc
acgatggacctagaggtggtgctgcgctgccaggactgcccccacatcgtccagtgcctt
ggctacctgatgacggagggggaggtgtggatctgcatggagctgatgtgcacctgcctg
gacaagcttctgcggcggctgcggccccgggccctgcccgaggacatcctgggccgcacg
gccctgggggtgctgcgggccctgcactacctcaaggagcgccacggcctcatccaccgg
gacgtgaagccctccaacgtgctgctcgaccgggccggaagggtgcgcctgtgcgacttc
ggcatcagcggccgcctcgtcgactccaaggcccgcacgcggtcggccggctgcgccgcc
tacatggcccccgagcggatcgacccgccggacccgaccaagccggattacgacatccgg
gcggacgtctggagcctgggcatatccatggtggagctggccacgggccagttcccgtac
aaggactgcaagacggactttgaggtgctgagccgggtgctgcaggaaaagccccccagc
ctgccgaacgacgggtccttctcccccgagttctgctcctttgtcaaagactgtcttaca
aaggactacagggagaggcccaagtaccgggagctcctggagcacccgttcatcaagcgc
tacgaaacgaaggaggtggacgttgcggcctggctggcggaggtcatggacggctcttcc
gaggacggactgtga

DBGET integrated database retrieval system