KEGG   Ixodes scapularis (black-legged tick): IscW_ISCW006929Help
Entry
IscW_ISCW006929   CDS       T01131                                 

Definition
hypothetical protein
Orthology
K04437  
filamin
Organism
isc  Ixodes scapularis (black-legged tick)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 2338 aa AA seqDB search
MQLDGIIGGKYLGVDPLLTAKELADPEVQPLGVMAYIARFQGMTPRRRPRDKLTVTGTDL
NNVHVNKPAHFKVHMKEGKVDLRQVRAEVRSPSLTPVECKLQLNQAGGSGTFVPVEIGMH
ALNVYCEGELVTGCPMHVRVHPDISRILFSGIDPCALGSLVEVLINSNGAGTGSIHVEAI
SPSGKSRECAVKDSDGVFTSTFMPNEIGSPFTIISVAEDTDQTSMTTDSFFTRTVASPIG
DAMSSSASSSFFASSHTSSRVTSPIKLDPDPGRASRTQFEPTLRTEMSRQSQESIAVTRT
ERMEVDAISKVVTSSSTTRVVTPERPASRQAPKAPPPPTPRKPAPAIPTPSPTSRNLEVE
ESSEELRRVDVQQRKTEVQAIASLTRDTATPEKPPSRKSPESRQMTPPVVAHRSTKEGDR
VDGREGLQHAHLQQLQQQQRRVVEQLASTTRESQGAPVESAARKTPEARQMAPARVGDVT
QVKISGEALKLVPVKRPTTFRISAPDFERDDFRVTVTAPSGREFPVRVDVLRPGELEVEF
ITPEVGEHVIEVKVEGRPLPGSPFRSHAFDATKIRVGDVPNGTVGRPVEFEIDGAEAGSG
NLEIMVNGDHVTSHVKPLGGHRFLASFVPRTATVHTVEMKFNGEKVPGSPWKCEVRDMPK
KGPISARGQALQTFSCGKVASFEVHAPGCSKDDLKVSIKGPGKSKIQHTVLERPDCHVVE
FATVDAGTYQIDVSVAGQRIPGSPFVSKAYDASCITLSDVPQSCLVGQTSQFQVDASRAG
EGQLEISVNDGEVPNQVQVLSSGRCLVSFKPLRPVPHVVSIKFNGENVPGCPVVLQVSDV
NQFSVDLSSLELVPVNVPSRFYVGGVSDEDDLRVTVMSPLEVKVPVKLSRSSRGGFNVEF
VPDQVGQYMVQVEIAGKVLAGTPAVVKAYDARKVDVSAVSQGTLGKPVQFTVDVSCAGEG
NLAITVTSRNRDVPTVVHPMGGAKFAVSFVPSDPSDHVISISFNKEPVPGSPFKVKVQDG
GKVTATDLSSLAAASVDKSVGFVIQNAGGREQDLSVRVEGPEGSPVPCSLKDIGDRNLRV
EFSPVRTGEHKVHVSHLGSPIPSSPFTCKVFDTRQIKVRDIPKGFVGKPVTFVVETAHAG
PGNLEVMVNNGRVSTTAQAQSPTQYAITFTPADDRPHVIDVRFNGEHVPGSPFQCQVADL
SKIKVVGEGIERVAVGRPAAFVVDTHGHDVGQFSVSILGPNQSPLKTHVTGNHHGGYRVE
YTPVEVGDHAVEILLGGESLAGSPFMSKVYDASKVRVADIGSGTVGRPVYFSIDASQAGA
GNLEIIVSVGGRNVPNYVQSEGNAKFRVNFKPSEPLTHTLSVKFNGEPVPGSPFFVKVSD
NTQSMVSGASLRTTSITRGAKFTIDSKGAEASDCKVSIVGPSGKKVPVTVTRTSPTTFDA
EFHPTEVGPNQVNVLLDGAALAGSPFTCNVYDVSKVRVTGLNPGIVNKPVTFQVDALQAG
NGTLELVVRTRKSSVCAEFAMKSHGIYEVTFVPTEKTPHYVNITFNEEDIPGNPFKIDIR
DGQPVIEPKAAPRTSSSPVVARGDGLKQGLVGSANAFEIDTNGAPGDIDIKVTGPSESHQ
VRTNVLQLDGRTYRAEYHTREVGLYRVEVLHGGSPISGKPFVVEVCDPSRVKVVDIEDGI
VGRSQTFRVDTTRAGHGTLNVVITAGGREVRNNIRESGPGVYKVSYVPKSDLPHKIDVYY
NGHQAPGCPQIVEVRDPGHVIIAHGAGLKACQLGKTCSFVIETGGYGDAKDFDILVSAPN
GSPLPVKCYQQKDGSLLVEWNAVTAGSHKVEVLYESKAIPGSPFLCQVFDASRVLLQKVR
GTTFSVNEKISFALNRRDAGYSELDVTVTSPLGRHLPIEVKGTPDGDGELIEFTPTVPGK
YRIAITYGGIEVPGPDSEPELTVEEEDEGVYSVSYLPLEIGVFDIHIRWNGKDVPGKLRV
EVRGPSDLVEARLEQTSGHRYRVTFTPREQGDHLMHIWYNDLAHPSSPFVAYAEPLAPAL
DHTRVVLRGHGLTGAKVGSEAEFVVDGSDAGPGAYLLNVMWSERQVKGCPLKVSVAASCD
AAKVLCSGEGLRGGTVGKEIKAFIDTRKGGPGELTAHCMGPHKMAHCELYDHRDGTFTLY
LKPQEGGRHLLTIKYGGDHIPGSPYTLRIAGAPDASKVRVYGPGIEPGVLAVYQSRFICD
TRGAGAGQLTVRIRGPKGAFRVEMQRESQKDRTILCKYDPTEPGDYRIEVKWSGEHVPGS
PFMVMIFDTQEELTRFVQGPYGTAGGAAPPVPSDYFGDGVAYGTGVGQMSWRGSTHEL
NT seq 7017 nt NT seq  +upstreamnt  +downstreamnt
atgcagcttgatggcattataggaggcaagtaccttggtgtggaccctttgctgaccgcc
aaggagctagcagaccccgaggtgcagcctctgggagtgatggcctacatcgcacgcttc
caagggatgacaccaaggcggaggccgcgcgacaagcttactgtcaccggcacggatctc
aacaacgtccatgtcaacaagcccgcccacttcaaggtgcacatgaaggaaggcaaggtg
gacttgaggcaggttcgcgctgaagtgcgcagcccgtccctgacccccgtcgagtgcaag
cttcaactgaaccaggccggcggatccggcacctttgtgcctgtcgagatcggcatgcac
gccctgaacgtgtactgtgaaggagagctggtgacgggttgcccgatgcacgtccgcgtt
caccccgacatctcacggatcctcttctctggaatcgatccttgcgccctcggatcgctc
gtcgaggtcctgatcaactctaacggtgcgggtacaggaagcattcacgtcgaggccatc
tctcccagcggaaagtcgagggagtgcgccgtcaaggacagtgacggcgtattcacctcc
acgttcatgcccaacgaaatcggctctcccttcaccatcatctccgtggccgaagacacc
gaccagacctccatgacgaccgactccttctttacccgcactgtcgcatctcccataggc
gacgccatgtctagctccgcctcctcctccttctttgcatcctcccacacctcctcgcgg
gtgacctcgcccatcaaactggaccccgaccccggccgtgcctcccgcacccagtttgag
ccgactttgcgaaccgagatgtctcggcagagccaggagagcatcgcagttacgagaact
gagcggatggaagtcgacgcaatcagtaaggttgtcacgtcttcgtcgacgacgagagta
gtcacaccggagagaccggcctcgaggcaagcgcctaaggcaccaccacctccgaccccg
aggaaaccggcgcccgcaattcccacgccgtccccaacaagccggaacctcgaggttgag
gaaagcagcgaagagctgcgaagggttgatgttcagcaacggaagacggaagttcaagcg
atcgcttcgttgacacgcgacaccgcgacaccggaaaagccgccttcgcggaagagtccg
gagtcgcggcagatgactccaccagtcgtggcccatcggtcgacgaaggagggggacagg
gtcgacgggagggagggtcttcagcatgcccatcttcagcagctgcagcagcagcagcgt
cgtgtcgttgaacagctcgcgtccacgacgcgggagagtcaaggcgcgcccgtcgagagt
gcagcacggaagacgcccgaagcgaggcagatggcgccagcgagagttggtgatgtgacc
caggtgaagatatcgggggaggcgctgaagctcgttccggtgaagcggccgaccacattc
cggatcagcgcgccggactttgagcgagacgacttccgggtgaccgttacggcaccgtct
ggacgcgagtttcccgtgcgtgtggatgtcctccggcccggggagcttgaggtggagttc
atcacacccgaagttggcgaacacgtgattgaagtcaaagtcgagggtcgacccctgcct
ggaagtccgttccgcagccatgctttcgacgcaaccaagattcgtgtcggtgacgtgccc
aacggaactgttggccgccccgttgaattcgaaatcgatggggcggaggctggctccggc
aacttggagatcatggtgaacggcgaccatgtgacgagccacgtgaagcccctgggggga
caccgcttcctggcctccttcgtgccacgcacggccactgtccacactgtcgagatgaag
ttcaacggcgagaaagtgccaggctccccgtggaagtgcgaggtccgagacatgccgaag
aaaggtcccatttctgcaaggggtcaggcgctgcagaccttcagctgtggcaaggtggct
agcttcgaggtgcatgctcccggctgcagcaaagacgacctcaaagtcagcatcaaaggc
cccggaaagtccaagatccagcacaccgttttagagcgtccggactgccatgtggtggag
tttgctactgttgacgctggcacataccagattgacgtgtcggtagcagggcagaggatt
cccggcagcccctttgtctccaaggcctatgacgcctcgtgcatcaccctcagtgacgtt
ccacagtcctgcttggtggggcagacctctcagttccaagttgatgcatcgagagctggc
gaaggacaactcgagatctctgtcaatgacggagaagtgcccaaccaggttcaggttctg
agcagcggacggtgcctcgtgagcttcaaaccgttgcgaccagtgccccacgtggtcagc
atcaagttcaacggcgaaaacgtgcccggttgtccggtggttcttcaggtgtcagatgtg
aaccagttttccgtggacctctcctccctggagctggttccggtcaacgtgcccagtcgc
ttctatgtcggcggagtgtctgatgaggacgacttgcgagtcaccgtcatgtcacctctc
gaggtcaaggtccctgtgaagttgagccgcagctcaaggggcggtttcaacgtcgagttt
gtgcccgaccaagtcggtcagtacatggtccaagtagagattgcaggaaaagttcttgct
gggacgccggccgtggtcaaagcatatgatgcccgcaaggttgatgtcagtgcagtttct
caggggacgttgggcaagcctgtccagtttacggtggacgtgagttgtgccggcgaaggc
aaccttgccatcacggtgacatctcgcaaccgagacgttcccaccgtggtccaccccatg
gggggcgccaagtttgccgtgtcgtttgtccccagtgatccgtcggaccatgtgatcagc
atcagcttcaataaagaacctgtgccagggagtcccttcaaggtgaaggtgcaggatggt
ggaaaggttacagccacggacctttcctcgctggcggcagcttcggtggacaaatccgtt
ggattcgtcatccagaatgcaggtggaagagagcaggacctctcagtcagggtcgaagga
cctgagggttctccagtgccttgttcgctcaaggacatcggagacaggaacctaagggtg
gagttctcccctgttcgaacaggggagcacaaggtccatgtgtcacacctgggcagtccc
atccccagcagcccattcacgtgcaaggtgtttgacacgcgtcagatcaaggtgcgtgac
atccccaagggctttgtgggaaagcctgtcacctttgtggtggagactgcgcatgcaggt
ccaggcaacctggaagtgatggtgaacaatggcagggtgtcaacaacagcccaggcgcag
tcgccgactcagtacgccatcaccttcactcctgcagacgaccgaccccatgtcattgat
gtgcgcttcaatggcgagcacgtcccagggagtccgttccagtgtcaagtggctgatctg
tccaagatcaaggtggtgggtgaaggcattgagagagtcgcagtgggacggccagctgct
ttcgtcgtggacactcacggacacgacgtgggacagttctcggtttctatacttggaccg
aaccagagcccgctgaagacacatgtgactggaaatcaccacgggggttaccgggtggag
tacacgcccgtcgaagtcggcgaccacgccgtggagatccttctcggaggcgagagcctg
gctggaagccccttcatgagcaaagtgtacgatgcctccaaggtccgggtggccgacatc
ggcagcggcacggtcggccggcctgtctacttcagcattgacgctagccaggcaggtgca
gggaatttggagatcatcgtgtcagtgggtggacgcaacgtgcccaactacgtacagtcg
gagggcaacgccaagttcagggtcaacttcaaacccagcgaaccccttacccacacgctc
agcgtaaagttcaacggggagcccgtaccaggcagccctttcttcgtgaaggtgagcgac
aacacccagtcgatggtgagcggtgcctcgctgagaaccacctccatcacccgcggtgcc
aagttcacgatcgactccaaaggcgccgaagcctccgattgcaaggtctccattgttggt
ccctctggcaaaaaggtgcctgtcactgtgaccagaacatcacccacaacttttgatgcc
gagtttcatcctacagaagttggtccaaaccaggtgaatgtgctgctcgacggagcagcc
ttggcaggcagtccttttacatgcaacgtctatgatgtaagcaaagttcgggtcactggt
ctgaaccctggaatcgtcaacaagcccgtcacctttcaagtggatgcactgcaggcaggc
aatggcaccctagagctggtggtgcggacgcgcaagtcatcagtgtgtgccgagtttgcc
atgaagagtcacggcatctacgaggtgacctttgtgcccacggaaaagactccacactat
gtcaacatcacattcaacgaagaggacatccccggcaatccattcaagattgacatccgg
gatggacagccggtcattgaacccaaggcggcgccaaggacaagctcgtcgcccgtggtt
gcacgaggcgacggcctcaaacagggactggttggctctgccaatgccttcgagattgac
accaacggtgctcctggagacatcgacatcaaagtcactggtccttcggagtcgcaccag
gtgcgcaccaacgtgctgcagctggacgggcgcacgtaccgggcggagtaccacacccgg
gaggtggggctgtatcgggtggaagtgctgcacgggggcagccccatctcgggcaagcct
tttgtggttgaggtgtgcgaccccagcagggtcaaggtcgtggacattgaggacggcatc
gtgggacgctcccagacgttcagggtggacacgacgcgtgcgggccacggcaccctcaac
gtcgtcatcacggcgggagggcgcgaggtccgcaacaacattcgggagtctgggccaggc
gtctacaaggtctcctacgtgcccaagtcggatttgccgcacaagatagacgtctactac
aacggtcaccaggcaccgggttgcccgcagattgtggaggtgcgcgacccaggccatgtg
atcattgcccacggggcgggactcaaggcctgccagctgggcaagacgtgcagcttcgtc
atcgagaccggtggttacggggacgccaaggacttcgacattcttgtgtccgcaccaaat
ggctcaccattgccggtgaagtgttaccagcagaaggatggaagcctcctggtggaatgg
aacgcagtaacggctggaagtcacaaggtggaggtgctgtacgagagcaaggccatccct
ggctcgccgttcctctgccaggtgtttgacgccagccgcgtgctgctccagaaagtccgt
ggcaccaccttttccgttaacgagaagatctcctttgcactgaaccgacgtgatgctggt
tactccgagctggacgtgacggtgaccagtcccctcgggcgccacttgcccattgaggtg
aagggcacgcccgacggcgacggcgagctcatcgagttcacgccaaccgtgcccgggaaa
taccgcattgccatcacctacggaggcatcgaagtgccaggtcctgactctgagcctgag
ctgaccgtagaggaagaagatgagggtgtctattctgtgtcatacttgcctcttgagatt
ggagtgtttgacatccacattcgttggaatggcaaggatgtgccaggcaagctcagggtg
gaggttcgagggcccagcgacctcgtggaggcccgcctggagcagacgagcggacatcgg
tacagggtgaccttcacaccccgtgaacaaggagaccacctgatgcacatctggtacaac
gacctggcccacccgagctccccgttcgtcgcctatgccgagcctttggctccggcgctt
gaccacacgagggtggtgctccggggtcatggactcacaggtgccaaggtcggatcggag
gcggagtttgtcgtcgacggttcggacgccgggccaggtgcctacctgctcaacgtgatg
tggtcggagcgtcaggtgaagggctgtccactgaaggtgagtgtggcagccagctgcgac
gccgccaaggtgctctgctccggagagggactgcgagggggcaccgtagggaaggagatc
aaggccttcatcgacactcgcaagggaggaccgggggagctgactgctcactgcatgggt
ccgcacaagatggcgcactgtgagctgtatgaccaccgggacggcaccttcaccttgtac
cttaagccccaggaaggggggcgccacctgctcaccatcaagtacggcggggaccacatc
ccaggaagtccatataccctgcgcatagcgggagctccagacgcctccaaggtgcgtgtc
tatgggccaggcatcgaaccaggcgtgcttgcagtgtaccagagccgcttcatttgcgac
acccggggcgctggggcaggacagctgacggtgcgcatcagaggacccaaaggtgccttc
cgtgtggagatgcagcgggaaagccagaaagaccgaaccatcctctgcaagtacgaccca
accgagcctggtgactaccgcatcgaggtgaagtggtcgggggagcatgtgccgggctcc
ccgtttatggtgatgatcttcgacacgcaagaggagctcacgcgctttgtccaggggccg
tacggcactgccggcggcgctgcaccaccagtgccttcggactactttggtgacggtgta
gcctatgggaccggggtcggccagatgtcctggcgaggctccacgcacgagctctaa

DBGET integrated database retrieval system