KEGG   Ixodes scapularis (black-legged tick): IscW_ISCW006982Help
Entry
IscW_ISCW006982   CDS       T01131                                 

Definition
GTP cyclohydrolase I, putative (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
isc  Ixodes scapularis (black-legged tick)
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:isc00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    IscW_ISCW006982
Enzymes [BR:isc01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     IscW_ISCW006982
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 156 aa AA seqDB search
MRNLCVTQVPAQPCFSFTEIVNDAVFLEDHDEMVIVKDIEMFSLCEHHLVPIIGKVSIGY
LPNKKVIGLSKLARIVEVYSRRLQVQERLTKQIAMAVTEAVGPTGVGVVIQASHMCMAMR
GVQKTSSQTITSTMLGVFREDPKTREEFLKLVLEHH
NT seq 471 nt NT seq  +upstreamnt  +downstreamnt
atgcgtaacctttgtgtaacgcaagtccctgcacaaccttgcttttctttcacagaaata
gtcaacgatgctgtgttcctggaggaccacgacgagatggtcattgtgaaggacattgag
atgttctccctgtgcgaacaccacctggtgcccatcataggcaaggtctccattggctac
ctcccaaacaagaaggtgattggcctgagcaaactggccaggattgtggaagtgtacagc
cgccgtctgcaagtgcaggagaggctcaccaagcaaatagccatggcggtcacggaagcc
gtcgggcccacgggagtcggagttgtcatccaagcctcccacatgtgcatggccatgcgc
ggagttcagaagacctccagccaaaccatcaccagcaccatgctgggtgtgttccgtgaa
gaccccaagacgcgtgaggagttcctcaagctggtcctcgagcaccactga

DBGET integrated database retrieval system