KEGG   Ixodes scapularis (black-legged tick): IscW_ISCW007018Help
Entry
IscW_ISCW007018   CDS       T01131                                 

Definition
hypothetical protein
Orthology
K06062  
histone acetyltransferase [EC:2.3.1.48]
Organism
isc  Ixodes scapularis (black-legged tick)
Pathway
Notch signaling pathway
Brite
KEGG Orthology (KO) [BR:isc00001]
 Environmental Information Processing
  Signal transduction
   04330 Notch signaling pathway
    IscW_ISCW007018
Enzymes [BR:isc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     IscW_ISCW007018
Transcription machinery [BR:isc03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     IscW_ISCW007018
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 570 aa AA seqDB search
MSSAPPTGSVAAPPGQTTPQGSSGNTPQGSSGNNLQRIAHKKSQVKAWPLNKKLEKLAIY
SSCKADDGCKCNGWKNPNLPQTPQRLEGPQPLANLNDPCRSCSHVLGAHVSHLENAPEEE
LNRLLGIVVDVENMFMCVHREEDADTKQVYFYLFKLLRKSILLMTRPTVEGPLGNPPFEK
PSIAKAVTNFVMHKFGHLSQKEWQTMYDLAKMFLHCLNHWKLETPSARKQQRQHSSNEDA
AAYKINYTRWLCFCHVPAFCDSLPHSETTMIFGRTLLRSVFQTMRRQLLDKFRAEKDKMP
AEKRTLVLTHFPRGFSELAARDEAARAEERKGLIEFHMVANALSKRVDQQSLVWLVGLQN
VFSHQLPRMPKEYITRLVFDPKHRTLALVKEGRIIGGICFRMFPGQGFTEIVFCAVTSNE
QVKGYGTHLMNHLKDYHVKQNILHFLTFADEFAIGYFKKQGFSKDIKLPKSVYTGYIKDY
EGATLMGCELDERISYTAFTHVIRKQKEVCTSGGSFYHLLRCLLENRYRPLGIIFFFNVF
RITVVRGLSKSQWRKQKLQTTMITSSIQWT
NT seq 1713 nt NT seq  +upstreamnt  +downstreamnt
atgtcgagcgcgccaccgactggctctgtcgctgcgccgccgggccaaaccactccgcaa
ggatcgtccggaaacacaccgcagggatcgtccgggaacaaccttcagaggatagcccac
aagaagtcgcaggtgaaggcctggccgctcaacaagaagctcgagaaactcgccatctat
tcgtcgtgcaaggcggacgatggctgcaagtgcaatggctggaagaacccaaacctaccc
cagaccccgcaacggctcgagggaccccagcctctggccaacctcaacgatccctgtcgc
agctgcagccacgttttgggggcacatgtgtctcaccttgagaatgcaccggaggaagag
ctcaacagactccttgggatcgtggtggacgttgagaacatgttcatgtgcgtccatcgt
gaggaggatgcagacaccaaacaagtctacttctatctgttcaagctgctgcgcaagagc
atcctcttgatgacacgccccaccgtagaaggaccacttggaaaccctcccttcgagaag
ccaagcatcgcaaaggcagtcaccaacttcgtgatgcacaagtttgggcacctgtcgcag
aaggagtggcagaccatgtacgacctggccaagatgtttctccactgcctcaaccactgg
aagctggaaaccccttcggccaggaagcagcagcggcaacactcctccaacgaggacgcc
gccgcttacaagatcaactacaccaggtggctgtgcttctgccacgtgccggcgttctgt
gacagcctgccgcactcggagaccaccatgatcttcgggaggacgctgctccggtcggtg
ttccagacgatgcgtcgccagctgctggacaagttcagggccgaaaaggacaagatgcct
gccgagaagaggacgctcgtcctcacgcacttcccacgcggcttctcggagttggcggcg
agggacgaggcggcgcgtgccgaggaacgcaaggggctcatcgagttccacatggtggcc
aacgccctgagcaagcgggtggaccagcagtccctggtatggctggtggggctccagaac
gtcttctcccaccagctgccaaggatgcccaaggagtacatcaccaggctcgtctttgac
ccgaagcatcgcacgcttgctctggtgaaggaaggccgcatcattggcgggatttgcttt
cggatgtttccgggtcagggctttacggagatcgttttctgtgccgtcacctccaacgag
caggtcaagggttatgggactcacttgatgaaccacctgaaggattatcacgtgaagcag
aacatcctgcacttcctgactttcgcggacgaattcgcgattggctacttcaagaagcag
ggattctcaaaggacatcaagctgcccaagtcggtctacacggggtacatcaaagactac
gagggggcaacgctcatgggctgcgaactggacgagcggatatcctacacagcgttcacc
cacgtcattaggaagcagaaggaggtctgtacatctggtggcagtttctaccatttacta
cgatgtctgctcgaaaatcgttaccggcctcttggcatcatatttttttttaatgtcttc
agaatcacagtagtgcgtggcctttccaaaagccagtggagaaagcagaagctccagact
actatgatcacatcaagtatccaatggacttga

  All links  
No link information was found.   
DBGET integrated database retrieval system