KEGG   Ixodes scapularis (black-legged tick): IscW_ISCW007295Help
Entry
IscW_ISCW007295   CDS       T01131                                 

Definition
acireductone dioxygenase, putative
Orthology
K08967  
1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase [EC:1.13.11.53 1.13.11.54]
Organism
isc  Ixodes scapularis (black-legged tick)
Pathway
Cysteine and methionine metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Cysteine and methionine metabolism [PATH:isc00270]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 183 aa AA seqDB search
MVQAWYMDSDTTTDQREEHQLDPPVPVSIDEVRDKSGVLYWKLNADTYEQDGELEKIRKD
RGYSYTDVIEISRDKLPNYEDKIKTFFQEHLHSDEEIRFILAGSGYFDVRDCEDKWIRIQ
VTRGDLLVLPAGIYHRFTLDKQNYIKAMRLFVGEPVWTPINRPADEHPARFQYIESLRQG
IMV
NT seq 552 nt NT seq  +upstreamnt  +downstreamnt
atggtgcaagcctggtacatggacagcgacacaacgaccgaccaacgcgaagagcatcag
ctggaccctcccgtgccggtctcgattgacgaagttcgcgacaagtcgggggtgctctac
tggaagctgaacgccgacacttacgagcaggatggagaacttgaaaagatacgcaaggac
aggggctactcgtacacggacgtgatcgagatctcgagggacaagttgccaaactatgag
gacaagattaagacattcttccaagaacacctacactcggatgaagagatccggttcatc
ttggctgggagcggctactttgacgtgcgcgattgcgaagacaagtggatccggattcag
gtgaccaggggagacttgctcgtcttgccagccggaatctaccaccggttcacgctggac
aagcagaactacatcaaggcaatgcggctttttgttggcgagcctgtgtggacgcccatc
aaccgcccggccgacgaacatcctgcaaggttccagtatatcgagagccttcgccagggc
atcatggtttga

DBGET integrated database retrieval system